Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10005
Gene name	Acyl-CoA thioesterase 8
Gene symbol	ACOT8
Synonyms (NCBI Gene)	HNAACTENAP1PTE-1PTE-2PTE1PTE2hACTE-IIIhTE
Chromosome	20
Chromosome location	20q13.12
Summary	The protein encoded by this gene is a peroxisomal thioesterase that appears to be involved more in the oxidation of fatty acids rather than in their formation. The encoded protein can bind to the human immunodeficiency virus-1 protein Nef, and mediate Nef

Show/Hide all (12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016798	hsa-miR-335-5p	Microarray	18185580
MIRT031404	hsa-miR-16-5p	Proteomics	18668040
MIRT2468702	hsa-miR-1266	CLIP-seq
MIRT2468703	hsa-miR-3664-3p	CLIP-seq
MIRT2468704	hsa-miR-3689a-3p	CLIP-seq
MIRT2468705	hsa-miR-3689c	CLIP-seq
MIRT2468706	hsa-miR-4421	CLIP-seq
MIRT2468707	hsa-miR-4450	CLIP-seq
MIRT2468708	hsa-miR-4518	CLIP-seq
MIRT2468709	hsa-miR-4728-5p	CLIP-seq
MIRT2468710	hsa-miR-4764-3p	CLIP-seq
MIRT2468711	hsa-miR-873	CLIP-seq

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003986	Function	Acetyl-CoA hydrolase activity	IEA
GO:0003986	Function	Acetyl-CoA hydrolase activity	TAS
GO:0004778	Function	Succinyl-CoA hydrolase activity	IEA
GO:0005515	Function	Protein binding	IPI	9153233, 9299485, 22190034, 25416956, 32296183, 33961781, 35156780
GO:0005777	Component	Peroxisome	IEA
GO:0005782	Component	Peroxisomal matrix	IBA
GO:0005782	Component	Peroxisomal matrix	IDA	10092594
GO:0005782	Component	Peroxisomal matrix	IEA
GO:0005782	Component	Peroxisomal matrix	IEA
GO:0005782	Component	Peroxisomal matrix	IMP	14709540
GO:0005782	Component	Peroxisomal matrix	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006636	Process	Unsaturated fatty acid biosynthetic process	IEA
GO:0006637	Process	Acyl-CoA metabolic process	IBA
GO:0006637	Process	Acyl-CoA metabolic process	IDA	9153233, 9299485
GO:0006637	Process	Acyl-CoA metabolic process	IEA
GO:0006637	Process	Acyl-CoA metabolic process	IEA
GO:0006637	Process	Acyl-CoA metabolic process	TAS
GO:0006699	Process	Bile acid biosynthetic process	TAS
GO:0007031	Process	Peroxisome organization	IEA
GO:0009062	Process	Fatty acid catabolic process	IBA
GO:0010561	Process	Negative regulation of glycoprotein biosynthetic process	IDA	9153233
GO:0016289	Function	Acyl-CoA hydrolase activity	TAS
GO:0016559	Process	Peroxisome fission	IDA	15194431
GO:0016787	Function	Hydrolase activity	IEA
GO:0033540	Process	Fatty acid beta-oxidation using acyl-CoA oxidase	TAS
GO:0033882	Function	Choloyl-CoA hydrolase activity	IEA
GO:0036109	Process	Alpha-linolenic acid metabolic process	IEA
GO:0036109	Process	Alpha-linolenic acid metabolic process	TAS
GO:0042759	Process	Long-chain fatty acid biosynthetic process	IEA
GO:0043649	Process	Dicarboxylic acid catabolic process	IDA	16141203
GO:0047603	Function	Acetoacetyl-CoA hydrolase activity	IEA
GO:0047617	Function	Fatty acyl-CoA hydrolase activity	IBA
GO:0047617	Function	Fatty acyl-CoA hydrolase activity	IDA	10092594, 15194431
GO:0047617	Function	Fatty acyl-CoA hydrolase activity	IEA
GO:0047617	Function	Fatty acyl-CoA hydrolase activity	TAS
GO:0047994	Function	Hydroxymethylglutaryl-CoA hydrolase activity	IEA
GO:0052689	Function	Carboxylic ester hydrolase activity	IEA
GO:0052815	Function	Medium-chain fatty acyl-CoA hydrolase activity	IDA	9153233, 9299485
GO:0052816	Function	Long-chain fatty acyl-CoA hydrolase activity	IDA	9153233
GO:0052816	Function	Long-chain fatty acyl-CoA hydrolase activity	IDA	9299485
GO:1901570	Process	Fatty acid derivative biosynthetic process	IEA

MIM	HGNC	e!Ensembl
608123	15919	ENSG00000101473

O14734

Protein name

Acyl-coenzyme A thioesterase 8 (Acyl-CoA thioesterase 8) (EC 3.1.2.1) (EC 3.1.2.11) (EC 3.1.2.2) (EC 3.1.2.3) (EC 3.1.2.5) (Choloyl-coenzyme A thioesterase) (EC 3.1.2.27) (HIV-Nef-associated acyl-CoA thioesterase) (Peroxisomal acyl-CoA thioesterase 2) (PT

Protein function

Catalyzes the hydrolysis of acyl-CoAs into free fatty acids and coenzyme A (CoASH), regulating their respective intracellular levels (PubMed:15194431, PubMed:9153233, PubMed:9299485). Displays no strong substrate specificity with respect to the

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13622	4HBT_3	45 → 308		Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in a T-cell line (at protein level). Ubiquitous (PubMed:9153233, PubMed:9299485). {ECO:0000269|PubMed:9153233, ECO:0000269|PubMed:9299485}.

Sequence

MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIV
GQALVAAAKSVSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKP
IFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAA
QEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYIGEGDMKMHCCVAAYISDYAFLGTAL
LPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRQDGVLAV
TCAQEGVIRVKPQVSESKL

Sequence length

319

Interactions

View interactions

	KEGG		Reactome
	Primary bile acid biosynthesis Metabolic pathways Peroxisome		Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol alpha-linolenic acid (ALA) metabolism Beta-oxidation of pristanoyl-CoA Beta-oxidation of very long chain fatty acids Peroxisomal protein import

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
INTESTINAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	18216211, 19081526, 19755166, 21487764, 24213847, 25782900, 28125650, 28501926, 28645479, 29174729, 29846557, 30052178, 30170546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34871464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32155177	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24788990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	23286385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20943860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30867003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	1711550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thiel-Behnke corneal dystrophy	Thiel-Behnke Corneal Dystrophy	BEFREE	28125650		★★★★★ ★☆☆☆☆ Found in Text Mining only

ACOT8 (acyl-CoA thioesterase 8)