GediPNet logo

FGF19 (fibroblast growth factor 19)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9965
Gene nameGene Name - the full gene name approved by the HGNC.
Fibroblast growth factor 19
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
FGF19
SynonymsGene synonyms aliases
-
ChromosomeChromosome number
11
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.3
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT639625 hsa-miR-4762-5p HITS-CLIP 23824327
MIRT648603 hsa-miR-29a-5p HITS-CLIP 23824327
MIRT639624 hsa-miR-676-5p HITS-CLIP 23824327
MIRT639623 hsa-miR-627-3p HITS-CLIP 23824327
MIRT639622 hsa-miR-615-5p HITS-CLIP 23824327
Transcription factors
Transcription factor Regulation Reference
ATF4 Activation 23205607
FOXC1 Activation 17000708
NR1I2 Activation 17696253
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade TAS
GO:0001934 Process Positive regulation of protein phosphorylation IBA 21873635
GO:0001934 Process Positive regulation of protein phosphorylation IDA 17627937
GO:0005104 Function Fibroblast growth factor receptor binding IBA 21873635
GO:0005104 Function Fibroblast growth factor receptor binding IPI 10525310, 17627937
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID O95750
Protein name Fibroblast growth factor 19 (FGF-19)
Protein function Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and
PDB 1PWA , 2P23 , 6KTR , 6NFJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00167 FGF
43 157
Fibroblast growth factor
Domain
Sequence
MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFL
RIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDC
AFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNR
GFLPLSHFLPMLPMVPEEPEDLR
GHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Sequence length 216
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Gastric cancer
  PI3K Cascade
PIP3 activates AKT signaling
betaKlotho-mediated ligand binding
FGFR4 ligand binding and activation
Constitutive Signaling by Aberrant PI3K in Cancer
Phospholipase C-mediated cascade; FGFR4
FRS-mediated FGFR4 signaling
SHC-mediated cascade:FGFR4
PI-3K cascade:FGFR4
Negative regulation of FGFR4 signaling
RAF/MAP kinase cascade
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Associated diseases
Unknown
Disease name Disease term dbSNP ID References
Liver carcinoma Liver carcinoma 25822088

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412