CDC25C (cell division cycle 25C)

Gene

• Entrez ID: 995
• Gene name: Cell division cycle 25C
• Gene symbol: CDC25C
• Synonyms: CDC25, PPP1R60
• Chromosome: 5
• Chromosome location: 5q31.2
• Summary: This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple al

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000751	hsa-miR-34a-5p	Review, Microarray	19461653
MIRT046939	hsa-miR-221-3p	CLASH	23622248
MIRT053101	hsa-miR-141-3p	Luciferase reporter assay, Western blot	23596351
MIRT053101	hsa-miR-141-3p	Luciferase reporter assay, Western blot	23596351
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT731272	hsa-miR-142-3p	qRT-PCR	26805039
MIRT877222	hsa-miR-1252	CLIP-seq
MIRT877223	hsa-miR-1266	CLIP-seq
MIRT877224	hsa-miR-4261	CLIP-seq
MIRT877225	hsa-miR-4518	CLIP-seq
MIRT877226	hsa-miR-4716-3p	CLIP-seq
MIRT877227	hsa-miR-4757-5p	CLIP-seq
MIRT877228	hsa-miR-544	CLIP-seq
MIRT877229	hsa-miR-625	CLIP-seq
MIRT877230	hsa-miR-767-3p	CLIP-seq
MIRT877226	hsa-miR-4716-3p	CLIP-seq
MIRT2446655	hsa-miR-583	CLIP-seq
MIRT877229	hsa-miR-625	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MYC	Activation	22446629
OTX2	Activation	21047732

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	11139144
GO:0000086	Process	G2/M transition of mitotic cell cycle	IBA	21873635
GO:0000086	Process	G2/M transition of mitotic cell cycle	IGI	2195549
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA	21873635
GO:0004725	Function	Protein tyrosine phosphatase activity	NAS	11078813
GO:0005515	Function	Protein binding	IPI	9543386, 11836499, 16330544, 17307877, 17349584, 19470455, 19597481, 24255178, 28330616
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	14968113
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005758	Component	Mitochondrial intermembrane space	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006977	Process	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS
GO:0007088	Process	Regulation of mitotic nuclear division	TAS	1828290
GO:0007283	Process	Spermatogenesis	IEA
GO:0008283	Process	Cell population proliferation	TAS	1828290
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IBA	21873635
GO:0016032	Process	Viral process	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0019901	Function	Protein kinase binding	IPI	9543386, 14968113
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050699	Function	WW domain binding	IPI	10037602
GO:0051301	Process	Cell division	IEA
GO:0110032	Process	Positive regulation of G2/MI transition of meiotic cell cycle	IBA	21873635

Other IDs

• MIM: 157680
• HGNC: 1727
• e!Ensembl: ENSG00000158402

Protein

• UniProt ID: P30307
• Protein name: M-phase inducer phosphatase 3 (EC 3.1.3.48) (Dual specificity phosphatase Cdc25C)
• Protein function: Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle (PubMed:8119945). When phosphorylated, highly effective in activating G2 cells into prophase (PubMed:8119945). Di
• PDB: 2OJX, 3BZI, 3OP3, 5M35, 5M36, 5M37
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06617	M-inducer_phosp	191 → 271	M-phase inducer phosphatase	Family
  PF00581	Rhodanese	308 → 422	Rhodanese-like domain	Domain

• Sequence:

  MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANL
  SILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMK
  CSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNP
  NLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDK
  VKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQ
  DLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKK
  PIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF
  PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP

• Sequence length: 473

Pathways

KEGG:

Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Human immunodeficiency virus 1 infection
MicroRNAs in cancer

Reactome:

Polo-like kinase mediated events
Activation of ATR in response to replication stress
RHO GTPases activate PKNs
TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain
Cyclin A/B1/B2 associated events during G2/M transition
Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex
Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	22832403, 30285260, 26198764, 28991256

Unknown
Disease name	Disease term	dbSNP ID	References
Liver carcinoma	Liver carcinoma		28284560