ZNF536 (zinc finger protein 536)

Gene

• Entrez ID: 9745
• Gene name: Zinc finger protein 536
• Gene symbol: ZNF536
• Synonyms: -
• Chromosome: 19
• Chromosome location: 19q12
• Summary: The protein encoded by this gene is a highly conserved zinc finger protein. The encoded protein is most abundant in brain, where it negatively regulates neuronal differentiation. [provided by RefSeq, Sep 2015]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2159774	hsa-miR-3920	CLIP-seq
MIRT2159775	hsa-miR-4766-3p	CLIP-seq
MIRT2379188	hsa-miR-1304	CLIP-seq
MIRT2379189	hsa-miR-3126-5p	CLIP-seq
MIRT2379190	hsa-miR-3664-3p	CLIP-seq
MIRT2159774	hsa-miR-3920	CLIP-seq
MIRT2379191	hsa-miR-4419a	CLIP-seq
MIRT2379192	hsa-miR-4510	CLIP-seq
MIRT2379193	hsa-miR-4659a-3p	CLIP-seq
MIRT2379194	hsa-miR-4659b-3p	CLIP-seq
MIRT2379195	hsa-miR-4753-3p	CLIP-seq
MIRT2379196	hsa-miR-510	CLIP-seq
MIRT2379197	hsa-miR-668	CLIP-seq
MIRT2379198	hsa-miR-942	CLIP-seq
MIRT2159774	hsa-miR-3920	CLIP-seq
MIRT2671271	hsa-miR-1243	CLIP-seq
MIRT2671272	hsa-miR-200b	CLIP-seq
MIRT2671273	hsa-miR-200c	CLIP-seq
MIRT2671274	hsa-miR-3123	CLIP-seq
MIRT2671275	hsa-miR-338-5p	CLIP-seq
MIRT2671276	hsa-miR-3654	CLIP-seq
MIRT2671277	hsa-miR-3675-5p	CLIP-seq
MIRT2671278	hsa-miR-3908	CLIP-seq
MIRT2671279	hsa-miR-3942-5p	CLIP-seq
MIRT2671280	hsa-miR-429	CLIP-seq
MIRT2671281	hsa-miR-4311	CLIP-seq
MIRT2671282	hsa-miR-4434	CLIP-seq
MIRT2671283	hsa-miR-4516	CLIP-seq
MIRT2671284	hsa-miR-4531	CLIP-seq
MIRT2671285	hsa-miR-4703-5p	CLIP-seq
MIRT2671286	hsa-miR-4720-3p	CLIP-seq
MIRT2159775	hsa-miR-4766-3p	CLIP-seq
MIRT2671287	hsa-miR-4802-5p	CLIP-seq
MIRT2671288	hsa-miR-4804-3p	CLIP-seq
MIRT2671289	hsa-miR-544	CLIP-seq
MIRT2671290	hsa-miR-642b	CLIP-seq
MIRT2671274	hsa-miR-3123	CLIP-seq
MIRT2671275	hsa-miR-338-5p	CLIP-seq
MIRT2671278	hsa-miR-3908	CLIP-seq
MIRT2671279	hsa-miR-3942-5p	CLIP-seq
MIRT2671281	hsa-miR-4311	CLIP-seq
MIRT2671282	hsa-miR-4434	CLIP-seq
MIRT2671283	hsa-miR-4516	CLIP-seq
MIRT2671284	hsa-miR-4531	CLIP-seq
MIRT2671285	hsa-miR-4703-5p	CLIP-seq
MIRT2671286	hsa-miR-4720-3p	CLIP-seq
MIRT2159775	hsa-miR-4766-3p	CLIP-seq
MIRT2671287	hsa-miR-4802-5p	CLIP-seq
MIRT2671288	hsa-miR-4804-3p	CLIP-seq
MIRT2671289	hsa-miR-544	CLIP-seq
MIRT2671290	hsa-miR-642b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	19398580
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19398580
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	19398580
GO:0005634	Component	Nucleus	IBA	21873635
GO:0006355	Process	Regulation of transcription, DNA-templated	IBA	21873635
GO:0044323	Function	Retinoic acid-responsive element binding	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048387	Process	Negative regulation of retinoic acid receptor signaling pathway	IEA

Other IDs

• MIM: 618037
• HGNC: 29025
• e!Ensembl: ENSG00000198597

Protein

• UniProt ID: O15090
• Protein name: Zinc finger protein 536
• Protein function: Transcriptional repressor that negatively regulates neuron differentiation by repressing retinoic acid-induced gene transcription (PubMed:19398580). Binds and interrupts RARA from binding to retinoic acid response elements (RARE) composed of tan
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	130 → 152	Zinc finger, C2H2 type	Domain
  PF13909	zf-H2C2_5	158 → 181		Domain
  PF00096	zf-C2H2	345 → 367	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	631 → 653	Zinc finger, C2H2 type	Domain
  PF16606	zf-C2H2_assoc	657 → 737		Disordered
  PF00096	zf-C2H2	752 → 773	Zinc finger, C2H2 type	Domain

• Sequence:

  MEEASLCLGVSSAEPEAEPHLSGPVLNGQYAMSQKLHQITSQLSHAFPELHPRPNPEEKP
  PASLEEKAHVPMSGQPMGSQMALLANQLGREVDTSLNGRVDLQQFLNGQNLGIMSQMSDI
  EDDARKNRKYPCPLCGKRFRFNSILSLHMRTHTGEKPFKCPYCDHRAAQKGNLKIHLRTH
  KLGNLGKGRGRVREENRLLHELEERAILRDKQLKGSLLQPRPDLKPPPHAQQAPLAACTL
  ALQANHSVPDVAHPVPSPKPASVQEDAVAPAAGFRCTFCKGKFKKREELDRHIRILHKPY
  KCTLCDFAASQEEELISHVEKAHITAESAQGQGPNGGGEQSANEFRCEVCGQVFSQAWFL
  KGHMRKHKDSFEHCCQICGRRFKEPWFLKNHMKVHLNKLSVKNKSPSDPEVPVPMGGMSQ
  EAHANLYSRYLSCLQSGFMTPDKAGLSEPSQLYGKGELPMKEKEALGKLLSPISSMAHGV
  PEGDKHSLLGCLNLVPPLKSSCIERLQAAAKAAEMDPVNSYQAWQLMARGMAMEHGFLSK
  EHPLQRNHEDTLANAGVLFDKEKREYVLVGADGSKQKMPADLVHSTKVGSQRDLPSKLDP
  LESSRDFLSHGLNQTLEYNLQGPGNMKEKPTECPDCGRVFRTYHQVVVHSRVHKRDRKGE
  EDGLHVGLDERRGSGSDQESQSVSRSTTPGSSNVTEESGVGGGLSQTGSAQEDSPHPSSP
  SSSDIGEEAGRSAGVQQPALLRDRSLGSAMKDCPYCGKTFRTSHHLKVHLRIHTGEKPYK
  CPHCDYAGTQSASLKYHLERHHRERQNGAGPLSGQPPNQDHKDEMSSKASLFIRPDILRG
  AFKGLPGIDFRGGPASQQWTSGVLSSGDHSGQATGMSSEVPSDALKGTDLPSKSTHFSEI
  GRAYQSIVSNGVNFQGSLQAFMDSFVLSSLKKEKDMKDKALADPPSMKVHGVDGGEEKPS
  GKSSQRKSEKSQYEPLDLSVRPDAASLPGSSVTVQDSIAWHGCLFCAFTTSSMELMALHL
  QANHLGKAKRKDNTIGVTVNCKDQAREASKMALLPSLQSNKDLGLSNMISSLDSASEKMA
  QGQLKETLGEQKSGAWTGHVDPAFCNFPSDFYKQFGVYPGMVGSGASSSCPNKEPDGKAH
  SEEDVPILIPETTSKNTTDDLSDIASSEDMDSSKGENNDEEDVETEPEMMTKPLSALSKD
  SSSDGGDSLQPTGTSQPVQGLVSPLSQAPEKQWHSQGLLQAQDPLAGLPKPERGPQSLDK
  PMNMLSVLRAYSSDGLAAFNGLASSTANSGCIKRPDLCGK

• Sequence length: 1300

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Hypertension	Hypertensive disease	rs13306026, rs13333226	26516778
Myocardial infarction	Myocardial Infarction	rs12316150, rs41303970, rs909253, rs7291467, rs2234693	26516778
Myopathy	Myopathy	rs137854521, rs386834236, rs121908557, rs121909092, rs111033570, rs104894299, rs104894294, rs121909273, rs121909274, rs121909275, rs199474699, rs199476140, rs118192165, rs118192169, rs118192166, rs193922856, rs281865489, rs397514675, rs397514676, rs397514677, rs367543058, rs118192117, rs193922837, rs118192129, rs118192143, rs118192153, rs118192133, rs118192156, rs118192149, rs118192148, rs118192183, rs118192147, rs118192123, rs118192127, rs118192142, rs118192144, rs118192178, rs118192151, rs118192150, rs118192184, rs118192154, rs118192134, rs118192155, rs193922893, rs118192132, rs118192146, rs193922867, rs193922884, rs587777528, rs527236030, rs587777672, rs587777673, rs587777674, rs587777675, rs587783343, rs2754158, rs786204796, rs748277951, rs797046047, rs797046064, rs797046060, rs797045479, rs797045931, rs797045932, rs797045934, rs797045935, rs797045477, rs797045478, rs1057518851, rs1057518855, rs1057518773, rs1057518866, rs1555322610, rs1555806119, rs761483896, rs144071404, rs1198364572, rs1568614042, rs978984063, rs1568604308, rs1332371891, rs1601842249, rs777176261, rs1249621033, rs1278804520, rs1568613962, rs1568510406, rs1597512576, rs193922887, rs371455345, rs1603452200, rs1599634685, rs1575065895, rs1575201712, rs139715157, rs1974129338	31220337
Myopia	Myopia, Degenerative	rs387907109, rs146936371, rs587776903, rs786205127, rs398122836, rs199624584, rs587777625, rs786205216, rs758872875, rs764211125, rs1135402746, rs765658563, rs1555941129, rs1555941116, rs199923805, rs782555528, rs1554862601, rs1586620121, rs1387950081, rs2051026773, rs1422332023	23049088
Papillary renal carcinoma	Papillary Renal Cell Carcinoma	rs5030823, rs2137087134, rs121913668, rs121913669, rs121913670, rs121913671, rs121913673, rs121913243, rs786202724	23797736
Renal carcinoma	Renal Cell Carcinoma, Conventional (Clear Cell) Renal Cell Carcinoma, Sarcomatoid Renal Cell Carcinoma, Collecting Duct Carcinoma of the Kidney	rs121913668, rs121913670, rs121913243, rs786202724	23797736
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	31268507, 25056061, 26198764, 29483656, 28991256, 30285260

Unknown
Disease name	Disease term	dbSNP ID	References
Chromophobe carcinoma	Chromophobe Renal Cell Carcinoma	rs137853247	23797736
Mental depression	Major Depressive Disorder	rs587778876, rs587778877	30718901