PICK1 (protein interacting with PRKCA 1)

Gene

• Entrez ID: 9463
• Gene name: Protein interacting with PRKCA 1
• Gene symbol: PICK1
• Synonyms: PICK, PRKCABP
• Chromosome: 22
• Chromosome location: 22q13.1
• Summary: The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha (PRKCA). This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT756128	hsa-miR-3131	Luciferase reporter assay, Western blotting, qRT-PCR	36718590
MIRT1233011	hsa-miR-4419a	CLIP-seq
MIRT1233012	hsa-miR-4510	CLIP-seq
MIRT1233013	hsa-miR-4728-5p	CLIP-seq
MIRT1233014	hsa-miR-4743	CLIP-seq
MIRT1233015	hsa-miR-939	CLIP-seq
MIRT1233016	hsa-miR-1245b-5p	CLIP-seq
MIRT1233017	hsa-miR-1321	CLIP-seq
MIRT1233018	hsa-miR-1827	CLIP-seq
MIRT1233019	hsa-miR-214	CLIP-seq
MIRT1233020	hsa-miR-3142	CLIP-seq
MIRT1233021	hsa-miR-3612	CLIP-seq
MIRT1233022	hsa-miR-3619-5p	CLIP-seq
MIRT1233023	hsa-miR-4270	CLIP-seq
MIRT1233024	hsa-miR-4441	CLIP-seq
MIRT1233025	hsa-miR-4530	CLIP-seq
MIRT1233026	hsa-miR-4650-5p	CLIP-seq
MIRT1233027	hsa-miR-4690-5p	CLIP-seq
MIRT1233028	hsa-miR-4739	CLIP-seq
MIRT1233029	hsa-miR-4756-5p	CLIP-seq
MIRT1233030	hsa-miR-491-3p	CLIP-seq
MIRT1233031	hsa-miR-650	CLIP-seq
MIRT1233032	hsa-miR-761	CLIP-seq
MIRT1233033	hsa-miR-940	CLIP-seq
MIRT2068590	hsa-miR-34a	CLIP-seq
MIRT2068591	hsa-miR-34c-5p	CLIP-seq
MIRT2068592	hsa-miR-4302	CLIP-seq
MIRT2068593	hsa-miR-449a	CLIP-seq
MIRT2068594	hsa-miR-449b	CLIP-seq
MIRT2068595	hsa-miR-486-3p	CLIP-seq
MIRT2392503	hsa-miR-532-3p	CLIP-seq
MIRT2593534	hsa-miR-124	CLIP-seq
MIRT2593535	hsa-miR-3667-3p	CLIP-seq
MIRT2593536	hsa-miR-3691-3p	CLIP-seq
MIRT2593537	hsa-miR-3714	CLIP-seq
MIRT2593538	hsa-miR-3910	CLIP-seq
MIRT2593539	hsa-miR-4469	CLIP-seq
MIRT2593540	hsa-miR-4715-3p	CLIP-seq
MIRT2593541	hsa-miR-4736	CLIP-seq
MIRT2593542	hsa-miR-506	CLIP-seq
MIRT2593543	hsa-miR-642a	CLIP-seq
MIRT1233033	hsa-miR-940	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	ISS
GO:0002092	Process	Positive regulation of receptor internalization	IBA	21873635
GO:0002092	Process	Positive regulation of receptor internalization	ISS
GO:0005080	Function	Protein kinase C binding	IBA	21873635
GO:0005080	Function	Protein kinase C binding	ISS
GO:0005102	Function	Signaling receptor binding	ISS
GO:0005515	Function	Protein binding	IPI	11802773, 16713569, 28514442, 32296183, 32814053
GO:0005543	Function	Phospholipid binding	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	11343649, 16314870
GO:0005794	Component	Golgi apparatus	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	11343649
GO:0005886	Component	Plasma membrane	TAS
GO:0006468	Process	Protein phosphorylation	ISS
GO:0006886	Process	Intracellular protein transport	IBA	21873635
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	NAS	10623590
GO:0007205	Process	Protein kinase C-activating G protein-coupled receptor signaling pathway	IDA	10623590
GO:0008021	Component	Synaptic vesicle	IBA	21873635
GO:0008022	Function	Protein C-terminus binding	IPI	11343649
GO:0014069	Component	Postsynaptic density	IBA	21873635
GO:0015844	Process	Monoamine transport	IDA	11343649
GO:0019899	Function	Enzyme binding	IPI	16314870
GO:0019904	Function	Protein domain specific binding	ISS
GO:0021782	Process	Glial cell development	ISS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0032588	Component	Trans-Golgi network membrane	IBA	21873635
GO:0034315	Process	Regulation of Arp2/3 complex-mediated actin nucleation	IBA	21873635
GO:0034316	Process	Negative regulation of Arp2/3 complex-mediated actin nucleation	ISS
GO:0036294	Process	Cellular response to decreased oxygen levels	ISS
GO:0042149	Process	Cellular response to glucose starvation	ISS
GO:0042734	Component	Presynaptic membrane	IDA	11343649
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0042802	Function	Identical protein binding	ISS
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0043005	Component	Neuron projection	ISS
GO:0043045	Process	DNA methylation involved in embryo development	NAS	12138111
GO:0043046	Process	DNA methylation involved in gamete generation	TAS	12138111
GO:0043113	Process	Receptor clustering	IBA	21873635
GO:0043113	Process	Receptor clustering	ISS
GO:0045161	Process	Neuronal ion channel clustering	TAS	11343649
GO:0045202	Component	Synapse	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0050796	Process	Regulation of insulin secretion	IMP	29768204
GO:0051015	Function	Actin filament binding	ISS
GO:0060292	Process	Long-term synaptic depression	ISS
GO:0071933	Function	Arp2/3 complex binding	ISS
GO:0097061	Process	Dendritic spine organization	ISS
GO:0097062	Process	Dendritic spine maintenance	IBA	21873635
GO:0097062	Process	Dendritic spine maintenance	ISS
GO:0098842	Component	Postsynaptic early endosome	IBA	21873635
GO:0140090	Function	Membrane curvature sensor activity	IDA	29768204

Other IDs

• MIM: 605926
• HGNC: 9394
• e!Ensembl: ENSG00000100151

Protein

• UniProt ID: Q9NRD5
• Protein name: PRKCA-binding protein (Protein interacting with C kinase 1) (Protein kinase C-alpha-binding protein)
• Protein function: Probable adapter protein that bind to and organize the subcellular localization of a variety of membrane proteins containing some PDZ recognition sequence. Involved in the clustering of various receptors, possibly by acting at the receptor inter
• PDB: 2GZV, 6AR4, 6BJN, 6BJO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00595	PDZ	22 → 102	PDZ domain	Domain
  PF06456	Arfaptin	117 → 352	Arfaptin-like domain	Domain

• Sequence:

  MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAAL
  DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKK
  VKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYEL
  SQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLN
  KAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRC
  RQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPI
  EVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS

• Sequence length: 415

Pathways

Reactome:

Trafficking of GluR2-containing AMPA receptors

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Male infertility	Male infertility due to globozoospermia	rs554675432, rs9332971, rs397507505, rs797045116, rs748618094, rs781431741, rs1555979575, rs377581367
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	16314870, 16983646, 17367885, 15305146

Unknown
Disease name	Disease term	dbSNP ID	References
Nonorganic psychosis	Nonorganic psychosis		17606663
Psychosis	Psychotic Disorders		17606663