Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
943 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
TNF receptor superfamily member 8 |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
TNFRSF8 |
SynonymsGene synonyms aliases
|
CD30, D1S166E, Ki-1 |
ChromosomeChromosome number
|
1 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
1p36.22 |
SummarySummary of gene provided in NCBI Entrez Gene.
|
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to th |
miRNAmiRNA information provided by mirtarbase database.
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
P28908 |
Protein name |
Tumor necrosis factor receptor superfamily member 8 (CD30L receptor) (Ki-1 antigen) (Lymphocyte activation antigen CD30) (CD antigen CD30) |
Protein function |
Receptor for TNFSF8/CD30L (PubMed:8391931). May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B (PubMed:8999898). {ECO:0000269|PubMed:83919 |
PDB |
1D01
|
Family and domains |
Pfam
Accession |
ID |
Position in sequence |
Description |
Type |
PF00020 |
TNFR_c6 |
108 → 149 |
TNFR/NGFR cysteine-rich region |
Domain |
|
Sequence |
MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQ RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN SCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPT PVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARC VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQA SKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYL ESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGL AGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
|
|
Sequence length |
595 |
Interactions |
View interactions |
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
|
|
Associated diseases
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Classical hodgkin lymphoma |
Mixed Cellularity Hodgkin Lymphoma, Lymphocyte Rich Classical Hodgkin Lymphoma, Nodular Lymphocyte Predominant Hodgkin Lymphoma |
|
16879607, 12453859 |
Eczema |
Eczema |
|
30595370 |
Hodgkin disease |
Hodgkin Disease |
|
12453859, 16879607 |
Hodgkin lymphoma |
Adult Hodgkin Lymphoma |
rs387906223, rs56391007, rs121913527, rs747694886 |
16879607, 12453859 |
Hodgkin lymphoma, lymphocyte depletion |
Hodgkin lymphoma, lymphocyte depletion |
|
12453859, 16879607 |
Malignant mesothelioma |
Malignant mesothelioma |
|
23056237 |
|