GediPNet logo

CD28 (CD28 molecule)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
940
Gene nameGene Name - the full gene name approved by the HGNC.
CD28 molecule
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
CD28
SynonymsGene synonyms aliases
IMD123, Tp44
ChromosomeChromosome number
2
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q33.2
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is essential for T-cell proliferation and survival, cytokine production, and T-helper type-2 development. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provide
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029645 hsa-miR-26b-5p Microarray 19088304
MIRT438542 hsa-miR-145-5p Luciferase reporter assay 24043548
MIRT438542 hsa-miR-145-5p Luciferase reporter assay 24043548
MIRT684938 hsa-miR-106a-5p HITS-CLIP 23313552
MIRT684937 hsa-miR-106b-5p HITS-CLIP 23313552
Transcription factors
Transcription factor Regulation Reference
EGR1 Unknown 10510368
NFKB1 Unknown 16365455
RELA Unknown 16365455
SP1 Unknown 10510368
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001772 Component Immunological synapse IEA
GO:0001816 Process Cytokine production TAS 8717514
GO:0002020 Function Protease binding IPI 12777399
GO:0002863 Process Positive regulation of inflammatory response to antigenic stimulus IEA
GO:0005515 Function Protein binding IPI 7568038, 7584133, 7807015, 8146197, 8183372, 9417079, 9784967, 10820259, 11285224, 15067037, 15554700, 18641334
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P10747
Protein name T-cell-specific surface glycoprotein CD28 (TP44) (CD antigen CD28)
Protein function Receptor that plays a role in T-cell activation, proliferation, survival and the maintenance of immune homeostasis (PubMed:1650475, PubMed:7568038). Functions not only as an amplifier of TCR signals but delivers unique signals that control intra
PDB 1YJD , 3WA4 , 5AUL , 5GJH , 5GJI , 6O8D , 7PPN , 7VU5 , 8S6Z , 8W2V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15910 V-set_2
23 139
ICOS V-set domain
Domain
Sequence
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLD
SAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPP
PYLDNEKSNGTIIHVKGKH
LCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVR
SKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Sequence length 220
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Cell adhesion molecules
T cell receptor signaling pathway
Intestinal immune network for IgA production
Type I diabetes mellitus
Measles
PD-L1 expression and PD-1 checkpoint pathway in cancer
Autoimmune thyroid disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
  PIP3 activates AKT signaling
Nef mediated downregulation of CD28 cell surface expression
Constitutive Signaling by Aberrant PI3K in Cancer
CD28 co-stimulation
CD28 dependent PI3K/Akt signaling
CD28 dependent Vav1 pathway
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Autoimmune diseases Autoimmune Diseases rs41285370, rs869025224 15494542, 19077085
Inflammatory bowel disease Inflammatory Bowel Diseases rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs139868987, rs750447828, rs368138379, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468 26192919
Lymphoma Lymphoma, T-Cell, Cutaneous rs11540652, rs1592119138, rs1592123162, rs1599367044 26192916, 26258847
Palmoplantar keratoderma Keratoderma, Palmoplantar rs59616921, rs1568039793, rs746488412, rs200564757, rs1567027297, rs781596375, rs1567027610, rs398123054, rs398123055, rs398123056, rs398123057, rs398122949, rs398122950, rs397515639, rs398122951, rs397515640, rs397515641, rs142859678, rs797044479, rs577442939, rs672601344, rs568609861, rs1057518846, rs1182196436, rs1567037561
Unknown
Disease name Disease term dbSNP ID References
Alopecia Alopecia
Celiac disease Celiac Disease rs2305764, rs35218876 25920553
Ectropion Ectropion
Eczema Eczema 30595370

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412