ADIPOQ (adiponectin, C1Q and collagen domain containing)

Gene

• Entrez ID: 9370
• Gene name: Adiponectin, C1Q and collagen domain containing
• Gene symbol: ADIPOQ
• Synonyms: ACDC, ACRP30, ADIPQTL1, ADPN, APM-1, APM1, GBP28
• Chromosome: 3
• Chromosome location: 3q27.3
• Summary: This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Apr 2010]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs876661321	G>T	Risk-factor	Upstream transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT691096	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT691097	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT691098	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT691099	hsa-miR-3122	HITS-CLIP	23313552
MIRT691100	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT691101	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT691102	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT691103	hsa-miR-3689c	HITS-CLIP	23313552
MIRT691104	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT691105	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT691106	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT691107	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT691108	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT691109	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT691110	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT691111	hsa-miR-6514-3p	HITS-CLIP	23313552
MIRT691112	hsa-miR-3165	HITS-CLIP	23313552
MIRT691113	hsa-miR-6745	HITS-CLIP	23313552
MIRT691114	hsa-miR-363-5p	HITS-CLIP	23313552
MIRT691115	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT691116	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT691117	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT691118	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT691119	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT691120	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT691121	hsa-miR-3656	HITS-CLIP	23313552
MIRT691122	hsa-miR-6811-3p	HITS-CLIP	23313552
MIRT691123	hsa-miR-214-5p	HITS-CLIP	23313552
MIRT691124	hsa-miR-6087	HITS-CLIP	23313552
MIRT691125	hsa-miR-383-3p	HITS-CLIP	23313552

Transcription factors

Transcription factor	Regulation	Reference
PPARG	Activation	20484463
PPARG	Unknown	18373719;19833717
SP1	Activation	12378384
TFAP2B	Repression	19325541

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	18431508
GO:0005102	Function	Signaling receptor binding	ISS	12368907
GO:0005125	Function	Cytokine activity	NAS	12611609
GO:0005179	Function	Hormone activity	IDA	11222466
GO:0005201	Function	Extracellular matrix structural constituent	RCA	28675934
GO:0005515	Function	Protein binding	IPI	12070119, 25910212, 31515488, 32296183, 32814053
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	TAS
GO:0005581	Component	Collagen trimer	IEA
GO:0005615	Component	Extracellular space	IDA	10403784, 15585515, 17327472
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0006006	Process	Glucose metabolic process	ISS	12368907
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	10095105
GO:0006635	Process	Fatty acid beta-oxidation	ISS	12368907
GO:0007165	Process	Signal transduction	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0009744	Process	Response to sucrose	IEA
GO:0009749	Process	Response to glucose	ISS	12368907
GO:0009967	Process	Positive regulation of signal transduction	ISS	12368907
GO:0009986	Component	Cell surface	IDA	10982546
GO:0010467	Process	Gene expression	IEA
GO:0010642	Process	Negative regulation of platelet-derived growth factor receptor signaling pathway	IDA	12070119
GO:0010739	Process	Positive regulation of protein kinase A signaling	IDA	10982546
GO:0010745	Process	Negative regulation of macrophage derived foam cell differentiation	IDA	11222466
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IDA	10604883
GO:0010875	Process	Positive regulation of cholesterol efflux	IDA	18703020
GO:0010906	Process	Regulation of glucose metabolic process	IDA	17327472
GO:0014823	Process	Response to activity	IEA
GO:0019395	Process	Fatty acid oxidation	ISS
GO:0030336	Process	Negative regulation of cell migration	ISS
GO:0030853	Process	Negative regulation of granulocyte differentiation	IDA	10961870
GO:0031953	Process	Negative regulation of protein autophosphorylation	IDA	12070119
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	10961870
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	19524870
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0033034	Process	Positive regulation of myeloid cell apoptotic process	IDA	10961870
GO:0033691	Function	Sialic acid binding	IDA	19855092
GO:0034115	Process	Negative regulation of heterotypic cell-cell adhesion	IDA	10604883
GO:0034383	Process	Low-density lipoprotein particle clearance	IDA	11222466
GO:0034612	Process	Response to tumor necrosis factor	IDA	10604883
GO:0035690	Process	Cellular response to drug	ISS
GO:0042304	Process	Regulation of fatty acid biosynthetic process	TAS
GO:0042593	Process	Glucose homeostasis	ISS	12368907
GO:0042802	Function	Identical protein binding	TAS	10961870
GO:0042803	Function	Protein homodimerization activity	IPI	12021245
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	ISS
GO:0043124	Process	Negative regulation of I-kappaB kinase/NF-kappaB signaling	IDA	10982546
GO:0043407	Process	Negative regulation of MAP kinase activity	ISS
GO:0045471	Process	Response to ethanol	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IDA	12021245
GO:0045650	Process	Negative regulation of macrophage differentiation	IDA	10961870
GO:0045721	Process	Negative regulation of gluconeogenesis	ISS	12368907
GO:0045776	Process	Negative regulation of blood pressure	IDA	17327472
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	18431508
GO:0045923	Process	Positive regulation of fatty acid metabolic process	ISS	12368907
GO:0046326	Process	Positive regulation of glucose import	ISS	12368907
GO:0046888	Process	Negative regulation of hormone secretion	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0050728	Process	Negative regulation of inflammatory response	NAS	12611609
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IEA
GO:0050765	Process	Negative regulation of phagocytosis	IDA	10961870
GO:0050805	Process	Negative regulation of synaptic transmission	IDA	17327472
GO:0050873	Process	Brown fat cell differentiation	ISS
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	28675934
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	12070119
GO:0070543	Process	Response to linoleic acid	IEA
GO:0070994	Process	Detection of oxidative stress	ISS
GO:0071320	Process	Cellular response to cAMP	IEA
GO:0071639	Process	Positive regulation of monocyte chemotactic protein-1 production	IDA	19524870
GO:0071872	Process	Cellular response to epinephrine stimulus	IEA
GO:0072659	Process	Protein localization to plasma membrane	IDA	18431508
GO:0090317	Process	Negative regulation of intracellular protein transport	IDA	18431508
GO:0110113	Process	Positive regulation of lipid transporter activity	IDA	18703020
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24531262, 26166748
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	24531262, 26166748
GO:1900121	Process	Negative regulation of receptor binding	IDA	12070119
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IDA	12070119
GO:1904753	Process	Negative regulation of vascular associated smooth muscle cell migration	IDA	12070119
GO:1905598	Process	Negative regulation of low-density lipoprotein receptor activity	IDA	11222466
GO:2000279	Process	Negative regulation of DNA biosynthetic process	IDA	12070119
GO:2000467	Process	Positive regulation of glycogen (starch) synthase activity	ISS
GO:2000478	Process	Positive regulation of metanephric glomerular visceral epithelial cell development	ISS
GO:2000481	Process	Positive regulation of cAMP-dependent protein kinase activity	IDA	18431508, 19524870
GO:2000534	Process	Positive regulation of renal albumin absorption	IDA	18431508
GO:2000584	Process	Negative regulation of platelet-derived growth factor receptor-alpha signaling pathway	ISS
GO:2000590	Process	Negative regulation of metanephric mesenchymal cell migration	ISS

Other IDs

• MIM: 605441
• HGNC: 13633
• e!Ensembl: ENSG00000181092

Protein

• UniProt ID: Q15848
• Protein name: Adiponectin (30 kDa adipocyte complement-related protein) (Adipocyte complement-related 30 kDa protein) (ACRP30) (Adipocyte, C1q and collagen domain-containing protein) (Adipose most abundant gene transcript 1 protein) (apM-1) (Gelatin-binding protein)
• Protein function: Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
• PDB: 4DOU, 6U66, 6U6N
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01391	Collagen	37 → 108	Collagen triple helix repeat (20 copies)	Repeat
  PF00386	C1q	114 → 239	C1q domain	Domain

• Sequence:

  MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDG
  TPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLE
  TYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDK
  AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLY
  HDTN

• Sequence length: 244

Pathways

KEGG:

PPAR signaling pathway
Hormone signaling
AMPK signaling pathway
Longevity regulating pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease
Alcoholic liver disease

Reactome:

AMPK inhibits chREBP transcriptional activation activity
Transcriptional regulation of white adipocyte differentiation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Diabetes mellitus	Diabetes Mellitus, Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs-1, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs371977235, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	12860835, 12114044, 12354786, 15734870
Papillary renal carcinoma	Papillary Renal Cell Carcinoma	rs5030823, rs2137087134, rs121913668, rs121913669, rs121913670, rs121913671, rs121913673, rs121913243, rs786202724	29723618
Chromophobe carcinoma	Chromophobe Renal Cell Carcinoma	rs-1	29723618
Rheumatoid arthritis	Rheumatoid Arthritis	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963	12833524
Adiponectin deficiency	Adiponectin Deficiency	rs121917815, rs876661321
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs-1, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	10092513, 14617771
Myocardial infarction	Myocardial Failure	rs12316150, rs41303970, rs909253, rs7291467, rs2234693	19367012, 26670611
Pulmonary fibrosis	Pulmonary Fibrosis	rs121918666, rs199422300, rs121917737, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs863223336, rs786205702, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578	25945502
Hypertension	Hypertensive disease	rs13306026	12860835
Renal carcinoma	Renal Cell Carcinoma, Conventional (Clear Cell) Renal Cell Carcinoma, Sarcomatoid Renal Cell Carcinoma, Collecting Duct Carcinoma of the Kidney	rs121913668, rs121913670, rs121913243, rs786202724	29723618
Metabolic syndrome	Metabolic Syndrome X	rs367643250, rs587777380, rs777736953	18162013, 17618945, 16793964, 20833989

Unknown
Disease name	Disease term	dbSNP ID	References
Crohn disease	Crohn Disease, Regional enteritis	rs2066847, rs2066844, rs886052047, rs5743265, rs111608429, rs104895438	21829567
Atherosclerosis	Atherosclerosis	rs699947, rs59439148	18931039
Heart failure	Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided	rs121918074, rs142027794, rs148791216, rs72648927, rs71578935, rs142416150, rs199830512, rs755445214, rs150102469, rs779568205, rs907992794, rs1202130741	26670611, 19367012
Congestive heart failure	Congestive heart failure	rs2301610, rs3833910, rs12301951, rs201674674, rs186741807, rs150140412, rs786205727, rs757840030, rs552050895, rs759465783, rs201978086, rs572757800, rs1572143354, rs749160569	26670611, 19367012
Alveolitis	Alveolitis, Fibrosing		25945502
Coronary restenosis	Coronary Restenosis		12138120
Crohn`s disease of large bowel	Crohn`s disease of large bowel		21829567
Crohn`s disease of the ileum	Crohn`s disease of the ileum		21829567
Diabetic nephropathy	Diabetic Nephropathy		17942768
Glomerulosclerosis	Nodular glomerulosclerosis		17942768
Hyperemia	Hyperemia		12860835
Hyperglycemia	Hyperglycemia		29991592
Hypoadiponectinemia	Hypoadiponectinemia
Ileocolitis	IIeocolitis		21829567
Kidney failure	Kidney Failure, Chronic		19539174
Myocardial ischemia	Myocardial Ischemia		16155579
Non-alcoholic fatty liver disease	Non-alcoholic Fatty Liver Disease, Nonalcoholic Steatohepatitis		20415685