LHX2 (LIM homeobox 2)

Gene

• Entrez ID: 9355
• Gene name: LIM homeobox 2
• Gene symbol: LHX2
• Synonyms: LH2, hLhx2
• Chromosome: 9
• Chromosome location: 9q33.3
• Summary: This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator. The protein can recapitulate or rescue phe

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022169	hsa-miR-124-3p	Microarray	18668037
MIRT042689	hsa-miR-196b-5p	CLASH	23622248
MIRT734416	hsa-miR-1238-3p	Immunohistochemistry (IHC), Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	32526477
MIRT735618	hsa-miR-409-3p	Immunohistochemistry (IHC), qRT-PCR	32040954
MIRT735620	hsa-miR-409-5p	Immunohistochemistry (IHC), qRT-PCR	32040954
MIRT1108985	hsa-miR-185	CLIP-seq
MIRT1108986	hsa-miR-3919	CLIP-seq
MIRT1108987	hsa-miR-4306	CLIP-seq
MIRT1108988	hsa-miR-4419a	CLIP-seq
MIRT1108989	hsa-miR-4510	CLIP-seq
MIRT1108990	hsa-miR-4644	CLIP-seq
MIRT1108991	hsa-miR-4797-5p	CLIP-seq
MIRT1108992	hsa-miR-583	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0030182	Process	Neuron differentiation	IBA	21873635
GO:0045893	Process	Positive regulation of transcription, DNA-templated	ISS
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 603759
• HGNC: 6594
• e!Ensembl: ENSG00000106689

Protein

• UniProt ID: P50458
• Protein name: LIM/homeobox protein Lhx2 (Homeobox protein LH-2) (LIM homeobox protein 2)
• Protein function: Acts as a transcriptional activator. Stimulates the promoter of the alpha-glycoprotein gene. Transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types (By similarity). {ECO:00
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00412	LIM	53 → 110	LIM domain	Domain
  PF00412	LIM	115 → 172	LIM domain	Domain
  PF00046	Homeodomain	267 → 323	Homeodomain	Domain

• Sequence:

  MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKI
  SDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHL
  GISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPAH
  FNHADVAAAAAAAAAAKSAGLGAAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAY
  NAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLA
  QKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKSTDAALQTGTPSGPASELSNASLSP
  SSTPTTLTDLTSPTLPTVTSVLTSVPGNLEGHEPHSPSQTTLTNLF

• Sequence length: 406

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Rheumatoid arthritis	Rheumatoid Arthritis	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212	17568789

Unknown
Disease name	Disease term	dbSNP ID	References
Stress disorder	Post-Traumatic Stress Disorder		25456346