GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

CD83 (CD83 molecule)

Gene

9308

CD83 molecule

CD83

BL11, HB15

6p23

The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to

Show/Hide all(99)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002516	hsa-miR-373-3p	Microarray	15685193
MIRT002516	hsa-miR-373-3p	Microarray;Other	15685193
MIRT021231	hsa-miR-146a-5p	Other	20375304
MIRT023390	hsa-miR-122-5p	Microarray	17612493
MIRT024870	hsa-miR-215-5p	Microarray	19074876
MIRT026759	hsa-miR-192-5p	Microarray	19074876
MIRT876291	hsa-miR-1324	CLIP-seq
MIRT876292	hsa-miR-137	CLIP-seq
MIRT876293	hsa-miR-1825	CLIP-seq
MIRT876294	hsa-miR-194	CLIP-seq
MIRT876295	hsa-miR-198	CLIP-seq
MIRT876296	hsa-miR-199a-5p	CLIP-seq
MIRT876297	hsa-miR-199b-5p	CLIP-seq
MIRT876298	hsa-miR-22	CLIP-seq
MIRT876299	hsa-miR-3136-5p	CLIP-seq
MIRT876300	hsa-miR-3925-3p	CLIP-seq
MIRT876301	hsa-miR-3977	CLIP-seq
MIRT876302	hsa-miR-4279	CLIP-seq
MIRT876303	hsa-miR-4439	CLIP-seq
MIRT876304	hsa-miR-4459	CLIP-seq
MIRT876305	hsa-miR-4513	CLIP-seq
MIRT876306	hsa-miR-4659a-3p	CLIP-seq
MIRT876307	hsa-miR-4659b-3p	CLIP-seq
MIRT876308	hsa-miR-4691-5p	CLIP-seq
MIRT876309	hsa-miR-4768-5p	CLIP-seq
MIRT876310	hsa-miR-4778-3p	CLIP-seq
MIRT876311	hsa-miR-563	CLIP-seq
MIRT876312	hsa-miR-665	CLIP-seq
MIRT876313	hsa-miR-942	CLIP-seq
MIRT876314	hsa-miR-4700-3p	CLIP-seq
MIRT876315	hsa-miR-548v	CLIP-seq
MIRT876306	hsa-miR-4659a-3p	CLIP-seq
MIRT876307	hsa-miR-4659b-3p	CLIP-seq
MIRT1959689	hsa-miR-302a	CLIP-seq
MIRT1959690	hsa-miR-302b	CLIP-seq
MIRT1959691	hsa-miR-302c	CLIP-seq
MIRT1959692	hsa-miR-302d	CLIP-seq
MIRT1959693	hsa-miR-302e	CLIP-seq
MIRT1959694	hsa-miR-3665	CLIP-seq
MIRT1959695	hsa-miR-372	CLIP-seq
MIRT1959696	hsa-miR-373	CLIP-seq
MIRT1959697	hsa-miR-376c	CLIP-seq
MIRT1959698	hsa-miR-4464	CLIP-seq
MIRT1959699	hsa-miR-4748	CLIP-seq
MIRT1959700	hsa-miR-519a	CLIP-seq
MIRT1959701	hsa-miR-519b-3p	CLIP-seq
MIRT1959702	hsa-miR-519c-3p	CLIP-seq
MIRT1959703	hsa-miR-520a-3p	CLIP-seq
MIRT1959704	hsa-miR-520b	CLIP-seq
MIRT1959705	hsa-miR-520c-3p	CLIP-seq
MIRT1959706	hsa-miR-520d-3p	CLIP-seq
MIRT1959707	hsa-miR-520e	CLIP-seq
MIRT1959708	hsa-miR-657	CLIP-seq
MIRT2196703	hsa-miR-1207-3p	CLIP-seq
MIRT2196704	hsa-miR-15a	CLIP-seq
MIRT2196705	hsa-miR-15b	CLIP-seq
MIRT2196706	hsa-miR-16	CLIP-seq
MIRT2196707	hsa-miR-195	CLIP-seq
MIRT876295	hsa-miR-198	CLIP-seq
MIRT1959689	hsa-miR-302a	CLIP-seq
MIRT1959690	hsa-miR-302b	CLIP-seq
MIRT1959691	hsa-miR-302c	CLIP-seq
MIRT1959692	hsa-miR-302d	CLIP-seq
MIRT1959693	hsa-miR-302e	CLIP-seq
MIRT1959694	hsa-miR-3665	CLIP-seq
MIRT2196708	hsa-miR-3677-5p	CLIP-seq
MIRT1959695	hsa-miR-372	CLIP-seq
MIRT1959696	hsa-miR-373	CLIP-seq
MIRT1959697	hsa-miR-376c	CLIP-seq
MIRT2196709	hsa-miR-424	CLIP-seq
MIRT2196710	hsa-miR-4434	CLIP-seq
MIRT876304	hsa-miR-4459	CLIP-seq
MIRT1959698	hsa-miR-4464	CLIP-seq
MIRT2196711	hsa-miR-4488	CLIP-seq
MIRT2196712	hsa-miR-4516	CLIP-seq
MIRT2196713	hsa-miR-4519	CLIP-seq
MIRT2196714	hsa-miR-4531	CLIP-seq
MIRT2196715	hsa-miR-4640-5p	CLIP-seq
MIRT2196716	hsa-miR-4672	CLIP-seq
MIRT2196717	hsa-miR-4697-5p	CLIP-seq
MIRT2196718	hsa-miR-4726-5p	CLIP-seq
MIRT2196719	hsa-miR-4731-5p	CLIP-seq
MIRT1959699	hsa-miR-4748	CLIP-seq
MIRT2196720	hsa-miR-497	CLIP-seq
MIRT1959700	hsa-miR-519a	CLIP-seq
MIRT1959701	hsa-miR-519b-3p	CLIP-seq
MIRT1959702	hsa-miR-519c-3p	CLIP-seq
MIRT1959703	hsa-miR-520a-3p	CLIP-seq
MIRT1959704	hsa-miR-520b	CLIP-seq
MIRT1959705	hsa-miR-520c-3p	CLIP-seq
MIRT1959706	hsa-miR-520d-3p	CLIP-seq
MIRT1959707	hsa-miR-520e	CLIP-seq
MIRT876311	hsa-miR-563	CLIP-seq
MIRT2196721	hsa-miR-637	CLIP-seq
MIRT1959708	hsa-miR-657	CLIP-seq
MIRT876312	hsa-miR-665	CLIP-seq
MIRT2465072	hsa-miR-3163	CLIP-seq
MIRT2465073	hsa-miR-3688-5p	CLIP-seq
MIRT2465074	hsa-miR-548c-3p	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
NFKB1	Activation	19164127
NFKB1	Unknown	12182451
PPARG	Activation	15356156
RELA	Activation	19164127
SP1	Unknown	12182451
SP3	Unknown	12182451

Show/Hide all(12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20374249, 32296183
GO:0005886	Component	Plasma membrane	TAS	9310491
GO:0005887	Component	Integral component of plasma membrane	TAS	8422464
GO:0006952	Process	Defense response	TAS	1378080
GO:0006959	Process	Humoral immune response	TAS	8422464
GO:0007165	Process	Signal transduction	TAS	9310491
GO:0009897	Component	External side of plasma membrane	IEA
GO:0014070	Process	Response to organic cyclic compound	IEA
GO:0032713	Process	Negative regulation of interleukin-4 production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0043372	Process	Positive regulation of CD4-positive, alpha-beta T cell differentiation	IEA

MIM	HGNC	e!Ensembl
604534	1703	ENSG00000112149

Protein

UniProt ID

Q01151

Protein name

CD83 antigen (hCD83) (B-cell activation protein) (Cell surface protein HB15) (CD antigen CD83)

Protein function

Transmembrane glycoprotein predominantly found on the surface of many immune cells including dendritic cells or lymphocytes that plays various roles in immune response regulation. Plays an essential role in CD4(+) T-selection, differentiation an

PDB

5MIX , 5MJ0 , 5MJ1 , 5MJ2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	19 → 127	Immunoglobulin V-set domain	Domain

Sequence

MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERM
ETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSG
KVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGM
ERAFLPVTSPNKHLGLVTPHKTELV

Sequence length

205

Interactions

View interactions

Associated diseases

Show/Hide Causal Diseases (2)

Causal
Disease name	Disease term	dbSNP ID	References
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504
Rheumatoid arthritis	Rheumatoid Arthritis	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212	22446963

Show/Hide Unknown Diseases (6)

Unknown
Disease name	Disease term	dbSNP ID	References
Arsenic encephalopathy	Arsenic Encephalopathy		16835338
Dermatologic disorders	Dermatologic disorders		16835338
Juvenile arthritis	Juvenile psoriatic arthritis		19565504
Seronegative polyarthritis	Polyarthritis, Juvenile, Rheumatoid Factor Negative		19565504
Polyarthritis, rheumatoid factor positive	Polyarthritis, Juvenile, Rheumatoid Factor Positive		19565504
Still disease	Juvenile-Onset Still Disease		19565504

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412