CD14 (CD14 molecule)

Gene

• Entrez ID: 929
• Gene name: CD14 molecule
• Gene symbol: CD14
• Synonyms: -
• Chromosome: 5
• Chromosome location: 5q31.3
• Summary: The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide, and to viruses. This gene has been id

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016817	hsa-miR-335-5p	Microarray	18185580

Transcription factors

Transcription factor	Regulation	Reference
KLF4	Activation	17762869
MEF2D	Activation	12213324
SP1	Activation	17203216
SP1	Unknown	11698458
SP2	Unknown	11698458
SP3	Unknown	11698458
VDR	Activation	16402404
WT1	Activation	9484784

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IBA	21873635
GO:0001530	Function	Lipopolysaccharide binding	IDA	12594207
GO:0001847	Function	Opsonin receptor activity	TAS	2402637
GO:0002224	Process	Toll-like receptor signaling pathway	TAS
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS
GO:0002756	Process	MyD88-independent toll-like receptor signaling pathway	TAS
GO:0005515	Function	Protein binding	IPI	16880211, 20860622, 22265692, 25965346
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005794	Component	Golgi apparatus	IDA	16880211
GO:0005886	Component	Plasma membrane	TAS
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0006909	Process	Phagocytosis	TAS	9548256
GO:0006915	Process	Apoptotic process	TAS	9548256
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	8798531
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	TAS
GO:0009408	Process	Response to heat	IEA
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0010008	Component	Endosome membrane	TAS
GO:0016019	Function	Peptidoglycan immune receptor activity	TAS	8798531
GO:0030667	Component	Secretory granule membrane	TAS
GO:0031362	Component	Anchored component of external side of plasma membrane	IDA	3385210
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IBA	21873635
GO:0032026	Process	Response to magnesium ion	IEA
GO:0032481	Process	Positive regulation of type I interferon production	IBA	21873635
GO:0032729	Process	Positive regulation of interferon-gamma production	IBA	21873635
GO:0032729	Process	Positive regulation of interferon-gamma production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	15039339
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	12594207, 15294986
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	8612135
GO:0034128	Process	Negative regulation of MyD88-independent toll-like receptor signaling pathway	TAS
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IBA	21873635
GO:0034142	Process	Toll-like receptor 4 signaling pathway	ISS
GO:0034142	Process	Toll-like receptor 4 signaling pathway	TAS
GO:0034612	Process	Response to tumor necrosis factor	IEA
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	TAS
GO:0038123	Process	Toll-like receptor TLR1:TLR2 signaling pathway	TAS
GO:0038124	Process	Toll-like receptor TLR6:TLR2 signaling pathway	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045087	Process	Innate immune response	IEA
GO:0045121	Component	Membrane raft	IBA	21873635
GO:0045121	Component	Membrane raft	IDA	16880211
GO:0045471	Process	Response to ethanol	IEA
GO:0045807	Process	Positive regulation of endocytosis	IEA
GO:0046696	Component	Lipopolysaccharide receptor complex	IBA	21873635
GO:0046696	Component	Lipopolysaccharide receptor complex	IDA	11274165
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0070266	Process	Necroptotic process	TAS
GO:0070891	Function	Lipoteichoic acid binding	IDA	12594207
GO:0071219	Process	Cellular response to molecule of bacterial origin	IDA	15039339
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	12594207
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	8612135
GO:0071223	Process	Cellular response to lipoteichoic acid	IDA	12594207
GO:0071723	Function	Lipopeptide binding	IDA	15294986
GO:0071726	Process	Cellular response to diacyl bacterial lipopeptide	IDA	16880211
GO:0071727	Process	Cellular response to triacyl bacterial lipopeptide	IDA	16880211
GO:0097190	Process	Apoptotic signaling pathway	TAS
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	IBA	21873635
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	IDA	15294986

Other IDs

• MIM: 158120
• HGNC: 1628
• e!Ensembl: ENSG00000170458

Protein

• UniProt ID: P08571
• Protein name: Monocyte differentiation antigen CD14 (My23 antigen) (Myeloid cell-specific leucine-rich glycoprotein) (CD antigen CD14) [Cleaved into: Monocyte differentiation antigen CD14, urinary form; Monocyte differentiation antigen CD14, membrane-bound form]
• Protein function: Coreceptor for bacterial lipopolysaccharide (PubMed:1698311, PubMed:23264655). In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopol
• PDB: 4GLP
• Sequence:

  MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIH
  AGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKE
  LTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQA
  HSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGV
  CAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR
  VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVG
  VSGTLVLLQGARGFA

• Sequence length: 375

Pathways

KEGG:

MAPK signaling pathway
NF-kappa B signaling pathway
Phagosome
Toll-like receptor signaling pathway
Hematopoietic cell lineage
Alcoholic liver disease
Shigellosis
Salmonella infection
Pertussis
Legionellosis
Amoebiasis
Tuberculosis
Transcriptional misregulation in cancer
Acute myeloid leukemia
Lipid and atherosclerosis

Reactome:

ER-Phagosome pathway
Caspase activation via Death Receptors in the presence of ligand
Toll Like Receptor 4 (TLR4) Cascade
Transfer of LPS from LBP carrier to CD14
MyD88:MAL(TIRAP) cascade initiated on plasma membrane
MyD88-independent TLR4 cascade
Toll Like Receptor TLR1:TLR2 Cascade
Toll Like Receptor TLR6:TLR2 Cascade
TRIF-mediated programmed cell death
MyD88 deficiency (TLR2/4)
IRAK4 deficiency (TLR2/4)
Regulation of TLR by endogenous ligand
Neutrophil degranulation
Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon
IKK complex recruitment mediated by RIP1
TRAF6-mediated induction of TAK1 complex within TLR4 complex
IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504
Asthma	Asthma	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	17607003

Unknown
Disease name	Disease term	dbSNP ID	References
Eczema	Eczema		19759553
Gout	Gout		26462562
Juvenile arthritis	Juvenile psoriatic arthritis		19565504
Liver cirrhosis	Liver Cirrhosis		20353583
Liver fibrosis	Fibrosis, Liver		20353583
Non-alcoholic fatty liver disease	Non-alcoholic Fatty Liver Disease, Nonalcoholic Steatohepatitis		20353583
Seronegative polyarthritis	Polyarthritis, Juvenile, Rheumatoid Factor Negative		19565504
Polyarthritis, rheumatoid factor positive	Polyarthritis, Juvenile, Rheumatoid Factor Positive		19565504
Still disease	Juvenile-Onset Still Disease		19565504