ARRDC1 (arrestin domain containing 1)

Gene

• Entrez ID: 92714
• Gene name: Arrestin domain containing 1
• Gene symbol: ARRDC1
• Synonyms: -
• Chromosome: 9
• Chromosome location: 9q34.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT043649	hsa-miR-326	CLASH	23622248
MIRT800644	hsa-miR-1915	CLIP-seq
MIRT800645	hsa-miR-2467-3p	CLIP-seq
MIRT800646	hsa-miR-3178	CLIP-seq
MIRT800647	hsa-miR-4436b-3p	CLIP-seq
MIRT800648	hsa-miR-4486	CLIP-seq
MIRT800649	hsa-miR-4685-5p	CLIP-seq
MIRT800650	hsa-miR-4726-3p	CLIP-seq
MIRT800644	hsa-miR-1915	CLIP-seq
MIRT1936499	hsa-miR-4715-3p	CLIP-seq
MIRT1936500	hsa-miR-4755-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	22315426, 23236378, 23886940, 27462458, 28514442, 32296183
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	22315426, 23236378, 27462458
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IMP	23886940
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IMP	27462458
GO:0006858	Process	Extracellular transport	IMP	22315426
GO:0015031	Process	Protein transport	IBA	21873635
GO:0015031	Process	Protein transport	IMP	27462458
GO:0016567	Process	Protein ubiquitination	IMP	27462458
GO:0031410	Component	Cytoplasmic vesicle	IDA	23236378
GO:0031625	Function	Ubiquitin protein ligase binding	IBA	21873635
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	22315426
GO:0042802	Function	Identical protein binding	IPI	22315426
GO:0045746	Process	Negative regulation of Notch signaling pathway	IMP	23886940
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070062	Component	Extracellular exosome	IDA	22315426
GO:0140112	Process	Extracellular vesicle biogenesis	IMP	27462458
GO:1903561	Component	Extracellular vesicle	IDA	22315426, 27462458
GO:1990756	Function	Ubiquitin ligase-substrate adaptor activity	IBA	21873635
GO:1990756	Function	Ubiquitin ligase-substrate adaptor activity	IMP	27462458
GO:1990763	Function	Arrestin family protein binding	IPI	23886940

Other IDs

• MIM: 619768
• HGNC: 28633
• e!Ensembl: ENSG00000197070

Protein

• UniProt ID: Q8N5I2
• Protein name: Arrestin domain-containing protein 1 (Alpha-arrestin 1)
• Protein function: Functions as an adapter recruiting ubiquitin-protein ligases to their specific substrates (PubMed:23886940, PubMed:27462458). Through an ubiquitination-dependent mechanism plays for instance a role in the incorporation of SLC11A2 into extracellu
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00339	Arrestin_N	7 → 139	Arrestin (or S-antigen), N-terminal domain	Domain
  PF02752	Arrestin_C	162 → 286	Arrestin (or S-antigen), C-terminal domain	Domain

• Sequence:

  MGRVQLFEISLSHGRVVYSPGEPLAGTVRVRLGAPLPFRAIRVTCIGSCGVSNKANDTAW
  VVEEGYFNSSLSLADKGSLPAGEHSFPFQFLLPATAPTSFEGPFGKIVHQVRAAIHTPRF
  SKDHKCSLVFYILSPLNLNSIPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVG
  QALQLHADVENQSGKDTSPVVASLLQKVSYKAKRWIHDVRTIAEVEGAGVKAWRRAQWHE
  QILVPALPQSALPGCSLIHIDYYLQVSLKAPEATVTLPVFIGNIAVNHAPVSPRPGLGLP
  PGAPPLVVPSAPPQEEAEAEAAAGGPHFLDPVFLSTKSHSQRQPLLATLSSVPGAPEPCP
  QDGSPASHPLHPPLCISTGATVPYFAEGSGGPVPTTSTLILPPEYSSWGYPYEAPPSYEQ
  SCGGVEPSLTPES

• Sequence length: 433

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Asthma	Asthma, Childhood asthma	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	31036433

Unknown
Disease name	Disease term	dbSNP ID	References
Eczema	Eczema		30595370