CD8A (CD8 subunit alpha)

Gene

• Entrez ID: 925
• Gene name: CD8 subunit alpha
• Gene symbol: CD8A
• Synonyms: CD8, CD8alpha, IMD116, Leu2, p32
• Chromosome: 2
• Chromosome location: 2p11.2
• Summary: The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize an

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs121918660	C>T	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007284	hsa-miR-196b-5p	Luciferase reporter assay	23359619
MIRT016928	hsa-miR-335-5p	Microarray	18185580
MIRT876396	hsa-miR-140-5p	CLIP-seq
MIRT876397	hsa-miR-2116	CLIP-seq
MIRT876398	hsa-miR-3617	CLIP-seq
MIRT876399	hsa-miR-4481	CLIP-seq
MIRT876400	hsa-miR-4745-5p	CLIP-seq
MIRT876401	hsa-miR-4758-5p	CLIP-seq
MIRT876402	hsa-miR-641	CLIP-seq
MIRT876403	hsa-miR-4527	CLIP-seq
MIRT1959724	hsa-miR-371b-5p	CLIP-seq
MIRT2196776	hsa-miR-1273e	CLIP-seq
MIRT2196777	hsa-miR-4503	CLIP-seq
MIRT876403	hsa-miR-4527	CLIP-seq
MIRT738188	hsa-miR-1285	CLIP-seq
MIRT2446627	hsa-miR-144	CLIP-seq
MIRT2446628	hsa-miR-2467-5p	CLIP-seq
MIRT738189	hsa-miR-3187-5p	CLIP-seq
MIRT738192	hsa-miR-326	CLIP-seq
MIRT738193	hsa-miR-330-5p	CLIP-seq
MIRT738187	hsa-miR-378g	CLIP-seq
MIRT738191	hsa-miR-4486	CLIP-seq
MIRT738190	hsa-miR-612	CLIP-seq
MIRT2446629	hsa-miR-760	CLIP-seq
MIRT2499916	hsa-miR-1270	CLIP-seq
MIRT2499917	hsa-miR-204	CLIP-seq
MIRT2499918	hsa-miR-211	CLIP-seq
MIRT2499919	hsa-miR-4531	CLIP-seq
MIRT2499920	hsa-miR-4755-5p	CLIP-seq
MIRT2499921	hsa-miR-4780	CLIP-seq
MIRT2499922	hsa-miR-620	CLIP-seq
MIRT2499923	hsa-miR-623	CLIP-seq
MIRT2499916	hsa-miR-1270	CLIP-seq
MIRT2499917	hsa-miR-204	CLIP-seq
MIRT2499918	hsa-miR-211	CLIP-seq
MIRT2499919	hsa-miR-4531	CLIP-seq
MIRT2499920	hsa-miR-4755-5p	CLIP-seq
MIRT2499921	hsa-miR-4780	CLIP-seq
MIRT2499922	hsa-miR-620	CLIP-seq
MIRT2499923	hsa-miR-623	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ETS1	Activation	8413295
GATA3	Activation	8413295

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002456	Process	T cell mediated immunity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	2470098, 2493728, 9177355, 12853576
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IDA	2784196
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	NAS	2496167
GO:0006955	Process	Immune response	NAS	11131152
GO:0007166	Process	Cell surface receptor signaling pathway	IBA	21873635
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	NAS	9830036
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0009897	Component	External side of plasma membrane	IDA	17213291
GO:0015026	Function	Coreceptor activity	NAS	11131152
GO:0019882	Process	Antigen processing and presentation	NAS	2496167
GO:0023024	Function	MHC class I protein complex binding	IDA	2784196, 9177355
GO:0042101	Component	T cell receptor complex	NAS	11131152
GO:0042110	Process	T cell activation	NAS	9830036
GO:0042288	Function	MHC class I protein binding	NAS	11131152
GO:0044853	Component	Plasma membrane raft	IDA	17341584
GO:0045065	Process	Cytotoxic T cell differentiation	IBA	21873635
GO:0050776	Process	Regulation of immune response	TAS

Other IDs

• MIM: 186910
• HGNC: 1706
• e!Ensembl: ENSG00000153563

Protein

• UniProt ID: P01732
• Protein name: T-cell surface glycoprotein CD8 alpha chain (T-lymphocyte differentiation antigen T8/Leu-2) (CD antigen CD8a)
• Protein function: Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:p
• PDB: 1AKJ, 1CD8, 1Q69, 2HP4, 3QZW, 7UMG, 7UVF, 8EW6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	26 → 133	Immunoglobulin V-set domain	Domain

• Sequence:

  MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQP
  RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSN
  SIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA
  CDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV

• Sequence length: 235

Pathways

KEGG:

Cell adhesion molecules
Antigen processing and presentation
Hematopoietic cell lineage
T cell receptor signaling pathway
Yersinia infection
Primary immunodeficiency

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Bronchiectasis	Bronchiectasis	rs121908758, rs121908811, rs76649725, rs267606722, rs121909008, rs387906360, rs387906361, rs80034486, rs74767530, rs121908776, rs121909012, rs77646904, rs121908754, rs121909015, rs121909016, rs387906365, rs80055610, rs75528968, rs121908748, rs77932196, rs121909026, rs121908751, rs121908750, rs746418935, rs79282516, rs77409459, rs121909031, rs76554633, rs75115087, rs79633941, rs387906375, rs75389940, rs121909043, rs387906379, rs121908784, rs121909047, rs137852709, rs1596894031, rs137852710, rs61759860, rs121908805, rs193922501, rs193922503, rs193922504, rs1554389296, rs121908812, rs74467662, rs193922510, rs193922514, rs121908797, rs193922515, rs76151804, rs78984783, rs77035409, rs193922532, rs121908767, rs77188391, rs121908789, rs121908779, rs36210737, rs121908763, rs121908794, rs121908796, rs121908772, rs79031340, rs397508137, rs397508139, rs121908774, rs397508150, rs397508152, rs397508158, rs397508165, rs397508168, rs397508173, rs397508192, rs397508196, rs397508200, rs397508205, rs397508208, rs397508211, rs397508222, rs397508225, rs397508231, rs397508243, rs397508251, rs397508261, rs397508272, rs397508273, rs397508276, rs397508295, rs397508296, rs397508298, rs397508300, rs77284892, rs397508310, rs201978662, rs201124247, rs121908780, rs397508331, rs397508333, rs397508339, rs397508341, rs121908760, rs397508350, rs397508353, rs121908810, rs397508360, rs374946172, rs145449046, rs397508377, rs397508379, rs397508380, rs397508386, rs397508387, rs397508393, rs397508399, rs397508400, rs397508412, rs397508413, rs121909034, rs149790377, rs121908792, rs397508426, rs397508431, rs397508441, rs397508451, rs397508461, rs397508479, rs397508482, rs397508496, rs397508498, rs397508506, rs397508510, rs142394380, rs121909036, rs139304906, rs121908798, rs397508532, rs397508535, rs146521846, rs139729994, rs397508570, rs397508572, rs77834169, rs78655421, rs121908765, rs397508595, rs397508596, rs397508600, rs397508604, rs397508609, rs397508616, rs397508620, rs397508624, rs121908808, rs397508635, rs397508636, rs397508637, rs397508658, rs397508673, rs397508680, rs397508686, rs76371115, rs397508702, rs397508706, rs397508712, rs397508715, rs397508721, rs397508732, rs397508734, rs397508740, rs121908771, rs397508761, rs78440224, rs121908793, rs397508767, rs121908803, rs397508777, rs397508784, rs397508791, rs397508796, rs397508799, rs397508805, rs397508808, rs397508809, rs397508824, rs786204693, rs755416052, rs397508263, rs1057516619, rs397508176, rs1057516415, rs1057516970, rs754392413, rs1057516457, rs397508709, rs1060503164, rs775663783, rs397508294, rs1554380497, rs397508163, rs121908785, rs1235397597, rs397508405, rs1554392800, rs375661578, rs397508693, rs766063304, rs141482808, rs1290078234, rs756219310, rs1554390958, rs1555112332, rs750559671, rs533959068, rs1554389062, rs1554389486, rs1330431481, rs193922730, rs779177972, rs1562928997, rs1562908997, rs1562876459, rs1584785196, rs1584786454, rs1299250440, rs1584837090, rs1584764596, rs1584812425
Chronic obstructive pulmonary disease	Chronic Obstructive Airway Disease	rs2227956, rs1008438, rs1043618, rs562047, rs1061581, rs2763979, rs6457452, rs13147758, rs1828591, rs13118928	17950725

Unknown
Disease name	Disease term	dbSNP ID	References
Cd8 deficiency	CD8 Deficiency, Familial		11435463, 17658607
Miscarriage	Miscarriage		18539642