GediPNet logo

CRLF1 (cytokine receptor like factor 1)
Gene
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9244
Gene nameGene Name - the full gene name approved by the HGNC.
Cytokine receptor like factor 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
CRLF1
SynonymsGene synonyms aliases
CISS, CISS1, CLF, CLF-1, NR6, zcytor5
ChromosomeChromosome number
19
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.11
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the cytokine type I receptor family. The protein forms a secreted complex with cardiotrophin-like cytokine factor 1 and acts on cells expressing ciliary neurotrophic factor receptors. The complex can promote survival of neuro
SNPsSNP information provided by dbSNP.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
SNP ID Visualize variation Clinical significance Consequence
rs104894668 A>C Pathogenic Coding sequence variant, missense variant
rs104894670 C>T Benign, pathogenic Coding sequence variant, missense variant
rs137853143 A>C,G Pathogenic Coding sequence variant, missense variant
rs137853144 T>A Pathogenic Coding sequence variant, stop gained
rs137853145 G>A,C,T Pathogenic Synonymous variant, coding sequence variant, missense variant, stop gained
miRNAmiRNA information provided by mirtarbase database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
miRTarBase ID miRNA Experiments Reference
MIRT019983 hsa-miR-375 Microarray 20215506
MIRT023159 hsa-miR-124-3p Microarray 18668037
MIRT030308 hsa-miR-26b-5p Microarray 19088304
MIRT610083 hsa-miR-8485 HITS-CLIP 23824327
MIRT610082 hsa-miR-329-3p HITS-CLIP 23824327
Transcription factors
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Transcription factor Regulation Reference
PLAG1 Activation 14712223
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
GO ID Ontology Definition Evidence Reference
GO:0001657 Process Ureteric bud development IEA
GO:0004896 Function Cytokine receptor activity IBA 21873635
GO:0005125 Function Cytokine activity IDA 10966616
GO:0005127 Function Ciliary neurotrophic factor receptor binding IDA 10966616
GO:0005515 Function Protein binding IPI 10966616, 19933857, 26858303
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM
HGNC
e!Ensembl
Protein
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O75462
Protein name Cytokine receptor-like factor 1 (Cytokine-like factor 1) (CLF-1) (ZcytoR5)
Protein function In complex with CLCF1, forms a heterodimeric neurotropic cytokine that plays a crucial role during neuronal development (Probable). May also play a regulatory role in the immune system.
PDB 8D7H
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09067 EpoR_lig-bind
131 → 228
Erythropoietin receptor, ligand binding
 Domain
PF00041 fn3
236 → 317
Fibronectin type III domain
 Domain
Sequence 
MPAGRRGPAAQSARRPPPLLPLLLLLCVLGAPRAGSGAHTAVISPQDPTLLIGSSLLATC
SVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARD
GSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQ
DNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDILDVVTTDPPPD
VHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAG
LKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSS
GPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGP
AR
Sequence length 422
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
 
Reactome
    IL-6-type cytokine receptor ligand interactions
Interleukin-27 signaling
Associated diseases
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Causal
Disease name Disease term dbSNP ID References
Cold-induced sweating syndrome COLD-INDUCED SWEATING SYNDROME 1, COLD-INDUCED SWEATING SYNDROME 2, Cold-induced sweating syndrome rs104894198, rs104894203, rs761746361, rs137853143, rs137853144, rs2145329741, rs137853145, rs367543004, rs137853929, rs137853932, rs137853934, rs137853935, rs768727082, rs137853928, rs879255557, rs879255558, rs780705654, rs879255556, rs1555758035, rs1600650861 12509788, 17436251, 17436252, 21326283, 23026229, 24488861, 16952376
Crisponi syndrome Crisponi syndrome rs1600651228 12509788, 17436251, 17436252
Keratitis Keratitis rs587776571
Scoliosis Scoliosis, unspecified rs1057518828, rs147296805, rs758163506, rs1555613564, rs1596852902, rs1596853067, rs1596853085
Unknown
Disease name Disease term dbSNP ID References
Achalasia Esophageal Achalasia 27976805
Acquired kyphoscoliosis Acquired Kyphoscoliosis
Congenital camptodactyly Congenital Camptodactyly
Congenital clubfoot Congenital clubfoot

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412