PTTG1 (PTTG1 regulator of sister chromatid separation, securin)

Gene

• Entrez ID: 9232
• Gene name: PTTG1 regulator of sister chromatid separation, securin
• Gene symbol: PTTG1
• Synonyms: EAP1, ECRAR, HPTTG, PTTG, TUTR1
• Chromosome: 5
• Chromosome location: 5q33.3
• Summary: The encoded protein is a homolog of yeast securin proteins, which prevent separins from promoting sister chromatid separation. It is an anaphase-promoting complex (APC) substrate that associates with a separin until activation of the APC. The gene product

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT052149	hsa-let-7b-5p	CLASH	23622248
MIRT050987	hsa-miR-17-5p	CLASH	23622248
MIRT050118	hsa-miR-26a-5p	CLASH	23622248
MIRT044923	hsa-miR-186-5p	CLASH	23622248
MIRT044427	hsa-miR-320a	CLASH	23622248
MIRT038103	hsa-miR-423-5p	CLASH	23622248
MIRT044923	hsa-miR-186-5p	Luciferase reporter assay	23671127
MIRT731822	hsa-miR-146a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27893422
MIRT731822	hsa-miR-146a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27893422
MIRT736622	hsa-miR-300	Luciferase reporter assay, qRT-PCR	33623402
MIRT736622	hsa-miR-300	Luciferase reporter assay, Western blotting, qRT-PCR	33624604

Transcription factors

Transcription factor	Regulation	Reference
KLF6	Repression	20116377;23977008
SP1	Activation	18339849
SP1	Unknown	14644503
TP53	Activation	12355087
TP53	Repression	15016801

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	NAS	12194817
GO:0005515	Function	Protein binding	IPI	12194817
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	9811450
GO:0005737	Component	Cytoplasm	TAS	9811450
GO:0005829	Component	Cytosol	IDA	9811450
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS
GO:0007283	Process	Spermatogenesis	TAS	9915854
GO:0010951	Process	Negative regulation of endopeptidase activity	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0045143	Process	Homologous chromosome segregation	IBA	21873635
GO:0051276	Process	Chromosome organization	IEA
GO:0051301	Process	Cell division	IEA
GO:2000816	Process	Negative regulation of mitotic sister chromatid separation	IBA	21873635

Other IDs

• MIM: 604147
• HGNC: 9690
• e!Ensembl: ENSG00000164611

Protein

• UniProt ID: O95997
• Protein name: Securin (Esp1-associated protein) (Pituitary tumor-transforming gene 1 protein) (Tumor-transforming protein 1) (hPTTG)
• Protein function: Regulatory protein, which plays a central role in chromosome stability, in the p53/TP53 pathway, and DNA repair. Probably acts by blocking the action of key proteins. During the mitosis, it blocks Separase/ESPL1 function, preventing the proteoly
• PDB: 7NJ0, 7NJ1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04856	Securin	1 → 191	Securin sister-chromatid separation inhibitor	Family

• Sequence:

  MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFDAPPALPKAT
  RKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTVKAKSSVPASDDAYPEIEKFFPF
  NPLDFESFDLPEEHQIAHLPLSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESNLLQ
  SPSSILSTLDVELPPVCCDIDI

• Sequence length: 202

Pathways

KEGG:

Cell cycle
Oocyte meiosis
Human T-cell leukemia virus 1 infection

Reactome:

APC/C:Cdc20 mediated degradation of Securin
APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Separation of Sister Chromatids

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Psoriasis	Psoriasis	rs281875215, rs587777763, rs281875213, rs281875212	20953187

Unknown
Disease name	Disease term	dbSNP ID	References
Liver carcinoma	Liver carcinoma		28284560
Palmoplantar pustules	Pustulosis of Palms and Soles		20953187
Sjogren`s syndrome	Sicca Syndrome, Sjogren`s Syndrome		24097067