AURKB (aurora kinase B)

Gene

• Entrez ID: 9212
• Gene name: Aurora kinase B
• Gene symbol: AURKB
• Synonyms: AIK2, AIM-1, AIM1, ARK-2, ARK2, AurB, IPL1, PPP1R48, STK-1, STK12, STK5, aurkb-sv1, aurkb-sv2
• Chromosome: 17
• Chromosome location: 17p13.1
• Summary: This gene encodes a member of the aurora kinase subfamily of serine/threonine kinases. The genes encoding the other two members of this subfamily are located on chromosomes 19 and 20. These kinases participate in the regulation of alignment and segregatio

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1597343914	G>A	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004742	hsa-miR-16-5p	Microarray, qRT-PCR	19738602
MIRT004742	hsa-miR-16-5p	Microarray, qRT-PCR	19738602
MIRT004742	hsa-miR-16-5p	Microarray, qRT-PCR	19738602
MIRT000120	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	19748357
MIRT000120	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	19748357
MIRT001649	hsa-let-7b-5p	pSILAC	18668040
MIRT020616	hsa-miR-155-5p	Proteomics	18668040
MIRT022319	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT000120	hsa-miR-24-3p	Reporter assay;Western blot;qRT-PCR;Other	19748357
MIRT004742	hsa-miR-16-5p	Proteomics	18668040
MIRT001649	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT049133	hsa-miR-92a-3p	CLASH	23622248
MIRT048044	hsa-miR-148a-3p	CLASH	23622248
MIRT046053	hsa-miR-125b-5p	CLASH	23622248
MIRT053129	hsa-let-7a-5p	Luciferase reporter assay, Western blot	23769985
MIRT053129	hsa-let-7a-5p	Luciferase reporter assay, Western blot	23769985
MIRT053129	hsa-let-7a-5p	Luciferase reporter assay, Western blot	23769985
MIRT437396	hsa-let-7e-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23774216
MIRT437396	hsa-let-7e-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23774216
MIRT001649	hsa-let-7b-5p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	32856506
MIRT812182	hsa-let-7a	CLIP-seq
MIRT812183	hsa-let-7b	CLIP-seq
MIRT812184	hsa-let-7c	CLIP-seq
MIRT812185	hsa-let-7d	CLIP-seq
MIRT812186	hsa-let-7e	CLIP-seq
MIRT812187	hsa-let-7f	CLIP-seq
MIRT812188	hsa-let-7g	CLIP-seq
MIRT812189	hsa-let-7i	CLIP-seq
MIRT812190	hsa-miR-1248	CLIP-seq
MIRT812191	hsa-miR-188-5p	CLIP-seq
MIRT812192	hsa-miR-3124-3p	CLIP-seq
MIRT812193	hsa-miR-3162-5p	CLIP-seq
MIRT812194	hsa-miR-3173-3p	CLIP-seq
MIRT812195	hsa-miR-3927	CLIP-seq
MIRT812196	hsa-miR-4458	CLIP-seq
MIRT812197	hsa-miR-4475	CLIP-seq
MIRT812198	hsa-miR-4500	CLIP-seq
MIRT812199	hsa-miR-4650-3p	CLIP-seq
MIRT812200	hsa-miR-4672	CLIP-seq
MIRT812201	hsa-miR-4713-3p	CLIP-seq
MIRT812202	hsa-miR-570	CLIP-seq
MIRT812203	hsa-miR-765	CLIP-seq
MIRT812204	hsa-miR-98	CLIP-seq
MIRT1940221	hsa-miR-1284	CLIP-seq
MIRT1940222	hsa-miR-3679-3p	CLIP-seq
MIRT812200	hsa-miR-4672	CLIP-seq
MIRT812182	hsa-let-7a	CLIP-seq
MIRT812183	hsa-let-7b	CLIP-seq
MIRT812184	hsa-let-7c	CLIP-seq
MIRT812185	hsa-let-7d	CLIP-seq
MIRT812186	hsa-let-7e	CLIP-seq
MIRT812187	hsa-let-7f	CLIP-seq
MIRT812188	hsa-let-7g	CLIP-seq
MIRT812189	hsa-let-7i	CLIP-seq
MIRT1940221	hsa-miR-1284	CLIP-seq
MIRT812191	hsa-miR-188-5p	CLIP-seq
MIRT812194	hsa-miR-3173-3p	CLIP-seq
MIRT812195	hsa-miR-3927	CLIP-seq
MIRT812196	hsa-miR-4458	CLIP-seq
MIRT812197	hsa-miR-4475	CLIP-seq
MIRT812198	hsa-miR-4500	CLIP-seq
MIRT812199	hsa-miR-4650-3p	CLIP-seq
MIRT812200	hsa-miR-4672	CLIP-seq
MIRT812201	hsa-miR-4713-3p	CLIP-seq
MIRT812202	hsa-miR-570	CLIP-seq
MIRT812203	hsa-miR-765	CLIP-seq
MIRT812204	hsa-miR-98	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Unknown	15033491
E2F4	Unknown	15033491

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	20959462
GO:0000776	Component	Kinetochore	IDA	22024163
GO:0000779	Component	Condensed chromosome, centromeric region	IDA	18195732, 19465021
GO:0002903	Process	Negative regulation of B cell apoptotic process	IDA	20959462
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	21397845
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	22724069, 28751710
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	TAS	19774610
GO:0005515	Function	Protein binding	IPI	12689593, 15064709, 16179162, 16239925, 16291752, 17099693, 17681274, 17726514, 17956729, 18243099, 18477699, 19357306, 20562864, 20739936, 20959462, 21051298, 21346195, 21988832, 22939624, 23036704, 24571573, 24857377, 25036637, 26829474, 27332895, 28514442, 29340707, 29568061
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	20959462
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005819	Component	Spindle	TAS	19774610
GO:0005829	Component	Cytosol	TAS
GO:0005876	Component	Spindle microtubule	IBA	21873635
GO:0006468	Process	Protein phosphorylation	IDA	21820309, 22724069
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS
GO:0007051	Process	Spindle organization	IMP	21820309
GO:0007052	Process	Mitotic spindle organization	IBA	21873635
GO:0007094	Process	Mitotic spindle assembly checkpoint	IEA
GO:0007568	Process	Aging	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008608	Process	Attachment of spindle microtubules to kinetochore	TAS	19774610
GO:0009838	Process	Abscission	ISS
GO:0010369	Component	Chromocenter	IEA
GO:0016570	Process	Histone modification	TAS	19774610
GO:0019900	Function	Kinase binding	IPI	23036704
GO:0030496	Component	Midbody	IDA	17726514
GO:0030496	Component	Midbody	TAS	19774610
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031616	Component	Spindle pole centrosome	IBA	21873635
GO:0032091	Process	Negative regulation of protein binding	IDA	21820309
GO:0032133	Component	Chromosome passenger complex	IBA	21873635
GO:0032133	Component	Chromosome passenger complex	IPI	15260989, 18591255
GO:0032133	Component	Chromosome passenger complex	TAS	19774610
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IMP	21531765
GO:0032465	Process	Regulation of cytokinesis	IBA	21873635
GO:0032466	Process	Negative regulation of cytokinesis	ISS
GO:0032467	Process	Positive regulation of cytokinesis	IMP	16103226
GO:0032467	Process	Positive regulation of cytokinesis	TAS	19774610
GO:0034501	Process	Protein localization to kinetochore	IMP	19468067
GO:0034644	Process	Cellular response to UV	IDA	20959462
GO:0035174	Function	Histone serine kinase activity	IBA	21873635
GO:0035174	Function	Histone serine kinase activity	ISS
GO:0036089	Process	Cleavage furrow formation	IDA	16103226
GO:0043988	Process	Histone H3-S28 phosphorylation	ISS
GO:0044878	Process	Mitotic cytokinesis checkpoint	ISS
GO:0046777	Process	Protein autophosphorylation	TAS	19774610
GO:0046872	Function	Metal ion binding	IEA
GO:0051233	Component	Spindle midzone	IBA	21873635
GO:0051256	Process	Mitotic spindle midzone assembly	IMP	16103226
GO:0051256	Process	Mitotic spindle midzone assembly	TAS	19774610
GO:0051973	Process	Positive regulation of telomerase activity	IMP	21531765
GO:0051983	Process	Regulation of chromosome segregation	TAS	19774610
GO:0097431	Component	Mitotic spindle pole	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:1904355	Process	Positive regulation of telomere capping	IMP	21531765
GO:1905116	Process	Positive regulation of lateral attachment of mitotic spindle microtubules to kinetochore	IDA	28751710
GO:1990023	Component	Mitotic spindle midzone	IEA

Other IDs

• MIM: 604970
• HGNC: 11390
• e!Ensembl: ENSG00000178999

Protein

• UniProt ID: Q96GD4
• Protein name: Aurora kinase B (EC 2.7.11.1) (Aurora 1) (Aurora- and IPL1-like midbody-associated protein 1) (AIM-1) (Aurora/IPL1-related kinase 2) (ARK-2) (Aurora-related kinase 2) (STK-1) (Serine/threonine-protein kinase 12) (Serine/threonine-protein kinase 5) (Serine
• Protein function: Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis (PubMed:11516652, PubMed:12925766, PubMed:14610074, PubMed:14722118, PubMed:29449677). The CPC complex has es
• PDB: 4AF3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	77 → 327	Protein kinase domain	Domain

• Sequence:

  MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
  SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
  QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
  MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
  PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
  QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA

• Sequence length: 344

Pathways

KEGG:

Polycomb repressive complex
Cell cycle

Reactome:

Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
SUMOylation of DNA replication proteins
RHO GTPases Activate Formins
Regulation of TP53 Activity through Phosphorylation
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802, rs28933369, rs121912469, rs80358011, rs397507262, rs80359439, rs397507333, rs80359543, rs80358831, rs80359596, rs80358920, rs80358972, rs80359659, rs397507404, rs397514661, rs80359516, rs200495564, rs80358419, rs80359274, rs80359283, rs80358427, rs80358428, rs80358435, rs81002805, rs397507660, rs397507663, rs80359391, rs80359443, rs81002797, rs80359466, rs397507752, rs80359484, rs80359603, rs397507954, rs80359058, rs80359071, rs397507981, rs80359121, rs80357086, rs80357064, rs397508936, rs80357695, rs80357661, rs397509035, rs80357544, rs80357577, rs80357881, rs80357296, rs80356923, rs80356866, rs80357504, rs80357390, rs80357239, rs80358099, rs397509284, rs80357258, rs199474738, rs199474747, rs587779204, rs63750439, rs267608076, rs587779246, rs63749999, rs267608078, rs63751327, rs267607719, rs267607734, rs63750706, rs63751711, rs587779047, rs587779075, rs267607949, rs63750633, rs63750803, rs63751618, rs267608154, rs200640585, rs80358018, rs80357857, rs80357882, rs180177103, rs587779815, rs587779865, rs587779872, rs587780059, rs121912666, rs587780088, rs587780104, rs200432447, rs180177100, rs587780226, rs587780784, rs587776416, rs587781276, rs587781629, rs587781694, rs587781727, rs587781730, rs587781807, rs587781894, rs587781948, rs121913344, rs587782292, rs587782350, rs587782558, rs587782719, rs587782885, rs587783057, rs730881833, rs730881411, rs730881336, rs139770721, rs730881869, rs730881633, rs730882007, rs786203115, rs765123255, rs1553333738, rs762083530, rs786202800, rs17174393, rs55996097, rs750621215, rs786203451, rs747604569, rs764389018, rs786204433, rs786204862, rs772821016, rs779582317, rs863225406, rs193922343, rs759965045, rs63749919, rs760228510, rs746481984, rs762307622, rs876659736, rs876660933, rs747727055, rs1450394308, rs876658348, rs876658431, rs876659326, rs876660444, rs730881369, rs878853865, rs753862052, rs587780024, rs138941496, rs886040739, rs886040744, rs886040347, rs878854957, rs886040123, rs398122662, rs886040942, rs1057517104, rs1057516320, rs1057516683, rs879254046, rs1057517253, rs587781927, rs985033810, rs1057519989, rs775464903, rs374230313, rs758304323, rs1060501599, rs758081262, rs1060500126, rs1060502734, rs587776408, rs1060501695, rs1114167816, rs1114167596, rs1114167667, rs1555460315, rs1135402788, rs1554086196, rs730881919, rs773356478, rs769237459, rs1553653158, rs587782087, rs1555107263, rs1555119940, rs1403784434, rs1342519012, rs751710099, rs1553616361, rs1553619721, rs1270783041, rs775036118, rs1555288557, rs1555460548, rs1555461154, rs1298667185, rs1553622218, rs63751101, rs1349928568, rs771936821, rs1021662947, rs1555921011, rs81002831, rs1555124506, rs1555574803, rs1060502716, rs1555605362, rs747057367, rs1565385010, rs1567554500, rs1567516230, rs1558644995, rs1555591308, rs778306619, rs1566231194, rs1603328466, rs1570406302, rs1586108714, rs768362387, rs1597713777, rs1060502926, rs1597867185, rs1591517571, rs1591663236, rs1593903006, rs1555284779, rs1597096243, rs45459799, rs1597360340, rs587781905, rs864622481, rs1601753141, rs1966858562, rs1966967065, rs1967016153, rs1967113484, rs2080473458, rs1591387978, rs1224428422, rs1597747184, rs2082309297, rs2051929740, rs147542208	15993841
Glomerulonephritis	IGA Glomerulonephritis	rs778043831	25133636

Unknown
Disease name	Disease term	dbSNP ID	References
Liver carcinoma	Liver carcinoma		28284560
Stomach neoplasms	Malignant neoplasm of stomach, Stomach Neoplasms		15993841