CD5 (CD5 molecule)

Gene

• Entrez ID: 921
• Gene name: CD5 molecule
• Gene symbol: CD5
• Synonyms: LEU1, T1
• Chromosome: 11
• Chromosome location: 11q12.2
• Summary: This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycop

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT875792	hsa-miR-1913	CLIP-seq
MIRT875793	hsa-miR-3064-5p	CLIP-seq
MIRT875794	hsa-miR-324-3p	CLIP-seq
MIRT875795	hsa-miR-3613-3p	CLIP-seq
MIRT875796	hsa-miR-4272	CLIP-seq
MIRT875797	hsa-miR-4313	CLIP-seq
MIRT875798	hsa-miR-4677-3p	CLIP-seq
MIRT875799	hsa-miR-4698	CLIP-seq
MIRT875800	hsa-miR-483-3p	CLIP-seq
MIRT875801	hsa-miR-502-5p	CLIP-seq
MIRT875802	hsa-miR-516a-3p	CLIP-seq
MIRT875803	hsa-miR-520d-5p	CLIP-seq
MIRT875804	hsa-miR-524-5p	CLIP-seq
MIRT875805	hsa-miR-548ae	CLIP-seq
MIRT875806	hsa-miR-548aj	CLIP-seq
MIRT875807	hsa-miR-548am	CLIP-seq
MIRT875808	hsa-miR-548x	CLIP-seq
MIRT875809	hsa-miR-604	CLIP-seq
MIRT875810	hsa-miR-647	CLIP-seq
MIRT875811	hsa-miR-668	CLIP-seq
MIRT875812	hsa-miR-892b	CLIP-seq
MIRT2196550	hsa-miR-3184	CLIP-seq
MIRT2196551	hsa-miR-423-5p	CLIP-seq
MIRT2446604	hsa-miR-1291	CLIP-seq
MIRT2446605	hsa-miR-2113	CLIP-seq
MIRT2446606	hsa-miR-4292	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005044	Function	Scavenger receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	1711157
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	11390434
GO:0005887	Component	Integral component of plasma membrane	NAS	1711157
GO:0006897	Process	Endocytosis	IEA
GO:0008037	Process	Cell recognition	NAS	1711157
GO:0009897	Component	External side of plasma membrane	IEA
GO:0031295	Process	T cell costimulation	IBA	21873635
GO:0038023	Function	Signaling receptor activity	NAS	1711157
GO:0097190	Process	Apoptotic signaling pathway	IEA

Other IDs

• MIM: 153340
• HGNC: 1685
• e!Ensembl: ENSG00000110448

Protein

• UniProt ID: P06127
• Protein name: T-cell surface glycoprotein CD5 (Lymphocyte antigen T1/Leu-1) (CD antigen CD5)
• Protein function: Lymphoid-specific receptor expressed by all T-cells and in a subset of B-cells known as B1a cells. Plays a role in the regulation of TCR and BCR signaling, thymocyte selection, T-cell effector differentiation and immune tolerance. Acts by intera
• PDB: 2JA4, 2JOP, 2JP0, 2OTT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00530	SRCR	38 → 133	Scavenger receptor cysteine-rich domain	Domain

• Sequence:

  MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVC
  SQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHS
  RNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGS
  LGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQ
  NSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAAL
  CDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYC
  KKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGP
  TGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPD
  NSSDSDYDLHGAQRL

• Sequence length: 495

Pathways

KEGG:

Hematopoietic cell lineage

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Rheumatoid arthritis	Rheumatoid Arthritis	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212	23143596

Unknown
Disease name	Disease term	dbSNP ID	References
Lymphocytic leukemia	Chronic Lymphocytic Leukemia		18006695