CCNB2 (cyclin B2)

Gene

• Entrez ID: 9133
• Gene name: Cyclin B2
• Gene symbol: CCNB2
• Synonyms: HsT17299
• Chromosome: 15
• Chromosome location: 15q22.2
• Summary: Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyc

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT052637	hsa-let-7a-5p	CLASH	23622248
MIRT051889	hsa-let-7b-5p	CLASH	23622248
MIRT051889	hsa-let-7b-5p	CLASH	23622248
MIRT051866	hsa-let-7c-5p	CLASH	23622248
MIRT051400	hsa-let-7f-5p	CLASH	23622248
MIRT046347	hsa-miR-23b-3p	CLASH	23622248
MIRT736557	hsa-miR-335-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	32636645
MIRT871247	hsa-miR-3168	CLIP-seq
MIRT871248	hsa-miR-335	CLIP-seq
MIRT871249	hsa-miR-433	CLIP-seq
MIRT871250	hsa-miR-4759	CLIP-seq
MIRT871251	hsa-miR-4799-5p	CLIP-seq
MIRT1958675	hsa-miR-1253	CLIP-seq
MIRT871247	hsa-miR-3168	CLIP-seq
MIRT871248	hsa-miR-335	CLIP-seq
MIRT1958676	hsa-miR-3663-5p	CLIP-seq
MIRT1958677	hsa-miR-4251	CLIP-seq
MIRT1958678	hsa-miR-4329	CLIP-seq
MIRT871249	hsa-miR-433	CLIP-seq
MIRT1958679	hsa-miR-4527	CLIP-seq
MIRT871250	hsa-miR-4759	CLIP-seq
MIRT871251	hsa-miR-4799-5p	CLIP-seq
MIRT1958675	hsa-miR-1253	CLIP-seq
MIRT871247	hsa-miR-3168	CLIP-seq
MIRT871248	hsa-miR-335	CLIP-seq
MIRT1958676	hsa-miR-3663-5p	CLIP-seq
MIRT1958677	hsa-miR-4251	CLIP-seq
MIRT1958678	hsa-miR-4329	CLIP-seq
MIRT871249	hsa-miR-433	CLIP-seq
MIRT1958679	hsa-miR-4527	CLIP-seq
MIRT871250	hsa-miR-4759	CLIP-seq
MIRT871251	hsa-miR-4799-5p	CLIP-seq
MIRT1958675	hsa-miR-1253	CLIP-seq
MIRT1958676	hsa-miR-3663-5p	CLIP-seq
MIRT1958677	hsa-miR-4251	CLIP-seq
MIRT1958678	hsa-miR-4329	CLIP-seq
MIRT1958679	hsa-miR-4527	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EP300	Unknown	12482752
TP53	Repression	12889596

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	IBA	21873635
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IBA	21873635
GO:0001701	Process	In utero embryonic development	IEA
GO:0005515	Function	Protein binding	IPI	15232106, 17408621, 23455922, 24358021, 28514442
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005813	Component	Centrosome	IBA	21873635
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007057	Process	Spindle assembly involved in female meiosis I	IEA
GO:0007077	Process	Mitotic nuclear envelope disassembly	TAS
GO:0008315	Process	G2/MI transition of meiotic cell cycle	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA	21873635
GO:0040008	Process	Regulation of growth	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0044772	Process	Mitotic cell cycle phase transition	IBA	21873635
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0048538	Process	Thymus development	IEA
GO:0051301	Process	Cell division	IEA
GO:0051726	Process	Regulation of cell cycle	TAS

Other IDs

• MIM: 602755
• HGNC: 1580
• e!Ensembl: ENSG00000157456

Protein

• UniProt ID: O95067
• Protein name: G2/mitotic-specific cyclin-B2
• Protein function: Essential for the control of the cell cycle at the G2/M (mitosis) transition.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00134	Cyclin_N	137 → 262	Cyclin, N-terminal domain	Domain
  PF02984	Cyclin_C	264 → 382	Cyclin, C-terminal domain	Domain

• Sequence:

  MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPV
  QPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDI
  DNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKF
  RLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNA
  YTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDM
  VHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTK
  FIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS

• Sequence length: 398

Pathways

KEGG:

FoxO signaling pathway
Cell cycle
Oocyte meiosis
p53 signaling pathway
Cellular senescence
Progesterone-mediated oocyte maturation
Human T-cell leukemia virus 1 infection
Human immunodeficiency virus 1 infection

Reactome:

Polo-like kinase mediated events
Resolution of Sister Chromatid Cohesion
Regulation of PLK1 Activity at G2/M Transition
Activation of NIMA Kinases NEK9, NEK6, NEK7
Initiation of Nuclear Envelope (NE) Reformation
Nuclear Pore Complex (NPC) Disassembly
Cyclin A/B1/B2 associated events during G2/M transition
G2/M DNA replication checkpoint
The role of GTSE1 in G2/M progression after G2 checkpoint

Associated diseases

Unknown
Disease name	Disease term	dbSNP ID	References
Liver carcinoma	Liver carcinoma		28284560