CLDN9 (claudin 9)

Gene

• Entrez ID: 9080
• Gene name: Claudin 9
• Gene symbol: CLDN9
• Synonyms: DFNB116
• Chromosome: 16
• Chromosome location: 16p13.3
• Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellula

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT045011	hsa-miR-186-5p	CLASH	23622248
MIRT1965519	hsa-miR-1252	CLIP-seq
MIRT1965520	hsa-miR-1343	CLIP-seq
MIRT1965521	hsa-miR-199a-5p	CLIP-seq
MIRT1965522	hsa-miR-199b-5p	CLIP-seq
MIRT1965523	hsa-miR-3194-5p	CLIP-seq
MIRT1965524	hsa-miR-4275	CLIP-seq
MIRT1965525	hsa-miR-4316	CLIP-seq
MIRT738249	hsa-miR-4437	CLIP-seq
MIRT1965526	hsa-miR-4476	CLIP-seq
MIRT1965527	hsa-miR-4493	CLIP-seq
MIRT1965528	hsa-miR-4674	CLIP-seq
MIRT1965529	hsa-miR-4676-5p	CLIP-seq
MIRT1965530	hsa-miR-4710	CLIP-seq
MIRT1965531	hsa-miR-4753-5p	CLIP-seq
MIRT1965532	hsa-miR-575	CLIP-seq
MIRT1965523	hsa-miR-3194-5p	CLIP-seq
MIRT1965529	hsa-miR-4676-5p	CLIP-seq
MIRT1965532	hsa-miR-575	CLIP-seq
MIRT2386154	hsa-miR-1184	CLIP-seq
MIRT2386155	hsa-miR-1587	CLIP-seq
MIRT2386156	hsa-miR-3173-5p	CLIP-seq
MIRT2386157	hsa-miR-3934	CLIP-seq
MIRT2386158	hsa-miR-4453	CLIP-seq
MIRT2386159	hsa-miR-4538	CLIP-seq
MIRT1965528	hsa-miR-4674	CLIP-seq
MIRT2386160	hsa-miR-635	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IMP	20375010
GO:0005198	Function	Structural molecule activity	IEA
GO:0005515	Function	Protein binding	IPI	20375010, 32296183
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	20375010
GO:0005923	Component	Bicellular tight junction	IBA	21873635
GO:0005923	Component	Bicellular tight junction	ISS
GO:0007155	Process	Cell adhesion	IBA	21873635
GO:0016021	Component	Integral component of membrane	IEA
GO:0016338	Process	Calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules	ISS
GO:0030054	Component	Cell junction	IDA
GO:0042802	Function	Identical protein binding	ISS
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0046718	Process	Viral entry into host cell	IEA
GO:0070830	Process	Bicellular tight junction assembly	IBA	21873635

Other IDs

• MIM: 615799
• HGNC: 2051
• e!Ensembl: ENSG00000213937

Protein

• UniProt ID: O95484
• Protein name: Claudin-9
• Protein function: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. ; (Microbial infection) Acts as a receptor for hepatitis C virus
• PDB: 6OV2, 6OV3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00822	PMP22_Claudin	4 → 181	PMP-22/EMP/MP20/Claudin family	Family

• Sequence:

  MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG
  QMQCKVYDSLLALPQDLQAARALCVIALLLALLGLLVAITGAQCTTCVEDEGAKARIVLT
  AGVILLLAGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGL
  LCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV

• Sequence length: 217

Pathways

KEGG:

Virion - Hepatitis viruses
Cell adhesion molecules
Tight junction
Leukocyte transendothelial migration
Pathogenic Escherichia coli infection
Hepatitis C

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17013881

Unknown
Disease name	Disease term	dbSNP ID	References
Prostatic neoplasms	Prostatic Neoplasms		17013881