GediPNet logo

ASH2L (ASH2 like, histone lysine methyltransferase complex subunit)
Gene
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9070
Gene nameGene Name - the full gene name approved by the HGNC.
ASH2 like, histone lysine methyltransferase complex subunit
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
ASH2L
SynonymsGene synonyms aliases
ASH2, ASH2L1, ASH2L2, Bre2
ChromosomeChromosome number
8
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p11.23
SNPsSNP information provided by dbSNP.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
SNP ID Visualize variation Clinical significance Consequence
rs1060499744 A>G Likely-pathogenic Missense variant, coding sequence variant
miRNAmiRNA information provided by mirtarbase database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
miRTarBase ID miRNA Experiments Reference
MIRT001383 hsa-miR-1-3p pSILAC 18668040
MIRT001383 hsa-miR-1-3p Proteomics;Other 18668040
MIRT038629 hsa-miR-125b-2-3p CLASH 23622248
MIRT036952 hsa-miR-877-3p CLASH 23622248
MIRT628737 hsa-miR-1253 HITS-CLIP 23824327
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
GO ID Ontology Definition Evidence Reference
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding IBA 21873635
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding IDA 16603732
GO:0005515 Function Protein binding IPI 12482968, 12670868, 16189514, 16603732, 16892064, 17178841, 17500065, 17925232, 17998332, 19047629, 19131338, 19187761, 19433796, 19556245, 20085832, 21220120, 21516116, 22722839, 23414517, 23870121, 23995757, 24981860, 25416956, 25456412, 31515488, 32296183, 32814053
GO:0005634 Component Nucleus IDA 15199122, 17500065, 18245475
GO:0005634 Component Nucleus IMP 22723415
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM
HGNC
e!Ensembl
Protein
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9UBL3
Protein name Set1/Ash2 histone methyltransferase complex subunit ASH2 (ASH2-like protein)
Protein function Transcriptional regulator (PubMed:12670868). Component or associated component of some histone methyltransferase complexes which regulates transcription through recruitment of those complexes to gene promoters (PubMed:19131338). Component of the
PDB 3RSN , 3S32 , 3TOJ , 4RIQ , 4X8N , 4X8P , 5F6K , 5F6L , 6E2H , 6KIU , 6KIV , 6KIW , 6KIX , 6KIZ , 6PWV , 6W5I , 6W5M , 6W5N , 7BRE , 7MBM , 7MBN , 7UD5 , 7W67 , 7W6A , 7W6I , 7W6J , 7W6L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00622 SPRY
420 → 498
SPRY domain
 Family
Sequence 
MAAAGAGPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPSSGEA
EGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGIC
TKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQS
RTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHP
DPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKR
KQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLEL
DCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGA
WYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGY
GQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSE
IIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWG
AVVEHTLADVLYHVETEVDGRRSPPWEP
Sequence length 628
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
 
KEGG
  
Reactome
  Cushing syndrome   Formation of the beta-catenin:TCF transactivating complex
PKMTs methylate histone lysines
Deactivation of the beta-catenin transactivating complex
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
Associated diseases
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Causal
Disease name Disease term dbSNP ID References
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291, rs886041382, rs1057518991, rs1057518699, rs753254213, rs748294403, rs762552974, rs1135401795, rs1553121073, rs1553122926, rs1364690005, rs1554086554, rs1554210415, rs1554168326, rs1554776342, rs1553873247, rs1567860112, rs779009256, rs1557447255, rs1564568350, rs780011005, rs1597464953, rs1200336864, rs1569513017, rs1587459606, rs1570332505, rs748888652, rs1575155995, rs2087029320, rs1589669105, rs1601769604, rs1184981709, rs749201074

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412