NAT1 (N-acetyltransferase 1)

Gene

• Entrez ID: 9
• Gene name: N-acetyltransferase 1
• Gene symbol: NAT1
• Synonyms: AAC1, MNAT, NAT-1, NATI
• Chromosome: 8
• Chromosome location: 8p22
• Summary: This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and h

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030309	hsa-miR-26b-5p	Microarray	19088304
MIRT050208	hsa-miR-25-3p	CLASH	23622248
MIRT1174316	hsa-miR-1264	CLIP-seq
MIRT1174317	hsa-miR-3613-3p	CLIP-seq
MIRT1174318	hsa-miR-548aa	CLIP-seq
MIRT1174319	hsa-miR-548ac	CLIP-seq
MIRT1174320	hsa-miR-548d-3p	CLIP-seq
MIRT1174321	hsa-miR-548z	CLIP-seq
MIRT1174322	hsa-miR-1305	CLIP-seq
MIRT1174317	hsa-miR-3613-3p	CLIP-seq
MIRT1174323	hsa-miR-3671	CLIP-seq
MIRT1174318	hsa-miR-548aa	CLIP-seq
MIRT1174319	hsa-miR-548ac	CLIP-seq
MIRT1174320	hsa-miR-548d-3p	CLIP-seq
MIRT1174321	hsa-miR-548z	CLIP-seq
MIRT1174324	hsa-miR-607	CLIP-seq
MIRT2050434	hsa-miR-582-3p	CLIP-seq
MIRT2279521	hsa-miR-1290	CLIP-seq
MIRT2279522	hsa-miR-2964a-5p	CLIP-seq
MIRT2279523	hsa-miR-3159	CLIP-seq
MIRT2279524	hsa-miR-4659a-3p	CLIP-seq
MIRT2279525	hsa-miR-4659b-3p	CLIP-seq
MIRT2279526	hsa-miR-4698	CLIP-seq
MIRT2391356	hsa-miR-151-5p	CLIP-seq
MIRT2391357	hsa-miR-151b	CLIP-seq
MIRT2391358	hsa-miR-3131	CLIP-seq
MIRT2391359	hsa-miR-611	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AR	Activation	17210686
HSF1	Activation	20176657

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004060	Function	Arylamine N-acetyltransferase activity	IBA	21873635
GO:0004060	Function	Arylamine N-acetyltransferase activity	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006805	Process	Xenobiotic metabolic process	TAS

Other IDs

• MIM: 108345
• HGNC: 7645
• e!Ensembl: ENSG00000171428

Protein

• UniProt ID: P18440
• Protein name: Arylamine N-acetyltransferase 1 (EC 2.3.1.5) (Arylamide acetylase 1) (Monomorphic arylamine N-acetyltransferase) (MNAT) (N-acetyltransferase type 1) (NAT-1)
• Protein function: Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.
• PDB: 2IJA, 2PQT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00797	Acetyltransf_2	20 → 280	N-acetyltransferase	Family

• Sequence:

  MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVV
  RRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYI
  VDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDL
  LEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLT
  HRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI

• Sequence length: 290

Pathways

KEGG:

Caffeine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis - DNA adducts

Reactome:

Acetylation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Dermatitis	Dermatitis, Occupational	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	19834256
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	12618593

Unknown
Disease name	Disease term	dbSNP ID	References
Benign neoplasm	Benign Neoplasm		11505221
Urinary bladder cancer	Malignant neoplasm of urinary bladder		16003747
Bladder neoplasm	Bladder Neoplasm		16003747
Industrial dermatosis	Industrial Dermatosis		19834256
Malignant neoplasm	Malignant Neoplasms		11505221
Neoplasms	Neoplasms		11505221
Prostatic neoplasms	Prostatic Neoplasms		12618593