FATE1 (fetal and adult testis expressed 1)

Gene

• Entrez ID: 89885
• Gene name: Fetal and adult testis expressed 1
• Gene symbol: FATE1
• Synonyms: CT43, FATE
• Chromosome: X
• Chromosome location: Xq28
• Summary: This gene encodes a cancer-testis antigen that is highly expressed in hepatocellular carcinomas and other tumors and weakly expressed in normal tissues except testis. The protein is strongly expressed in spermatogonia, primary spermatocytes, and Sertoli c

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2227289	hsa-miR-1910	CLIP-seq
MIRT2227290	hsa-miR-4691-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 21516116, 22458338, 25416956, 25910212, 26871637, 29892012, 31515488, 32296183
GO:0005741	Component	Mitochondrial outer membrane	IBA	21873635
GO:0005741	Component	Mitochondrial outer membrane	IDA	12865919
GO:0005783	Component	Endoplasmic reticulum	IBA	21873635
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IBA	21873635
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	26567849
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0043066	Process	Negative regulation of apoptotic process	IBA	21873635
GO:0043066	Process	Negative regulation of apoptotic process	IDA	12865919, 26567849
GO:0044233	Component	Mitochondria-associated endoplasmic reticulum membrane	IBA	21873635
GO:0044233	Component	Mitochondria-associated endoplasmic reticulum membrane	IDA	12865919
GO:0051562	Process	Negative regulation of mitochondrial calcium ion concentration	IBA	21873635
GO:0051562	Process	Negative regulation of mitochondrial calcium ion concentration	IDA	12865919

Other IDs

• MIM: 300450
• HGNC: 24683
• e!Ensembl: ENSG00000147378

Protein

• UniProt ID: Q969F0
• Protein name: Fetal and adult testis-expressed transcript protein (Cancer/testis antigen 43) (CT43) (Tumor antigen BJ-HCC-2)
• Protein function: Involved in the regulation of endoplasmic reticulum (ER)-mitochondria coupling. Negatively regulates the ER-mitochondria distance and Ca(2+) transfer from ER to mitochondria possibly implicating it in the regulation of apoptosis (PubMed:27402544
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05644	Miff	13 → 183	Mitochondrial and peroxisomal fission factor Mff	Family

• Sequence:

  MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAG
  SASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDA
  VAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLW
  MNQ

• Sequence length: 183

Associated diseases

Unknown
Disease name	Disease term	dbSNP ID	References
Liver carcinoma	Liver carcinoma		15580283