WNT3A (Wnt family member 3A)

Gene

• Entrez ID: 89780
• Gene name: Wnt family member 3A
• Gene symbol: WNT3A
• Synonyms: -
• Chromosome: 1
• Chromosome location: 1q42.13
• Summary: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000282	hsa-miR-15a-5p	Luciferase reporter assay	18931683
MIRT003430	hsa-miR-16-5p	Luciferase reporter assay	18931683
MIRT003430	hsa-miR-16-5p	Review	20130964
MIRT000282	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR	21106054
MIRT000282	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR	21106054
MIRT000282	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR	21106054
MIRT021725	hsa-miR-132-3p	Microarray	17612493
MIRT021973	hsa-miR-128-3p	Microarray	17612493
MIRT025061	hsa-miR-181a-5p	Microarray	17612493
MIRT027132	hsa-miR-103a-3p	Sequencing	20371350
MIRT003430	hsa-miR-16-5p	Sequencing	20371350
MIRT736324	hsa-miR-1236-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR, In situ hybridization, Flow cytometry	33133267
MIRT755445	hsa-miR-503-5p	Luciferase reporter assay, Western blotting, qRT-PCR	36555553
MIRT1493676	hsa-miR-103a	CLIP-seq
MIRT1493677	hsa-miR-107	CLIP-seq
MIRT1493678	hsa-miR-1224-3p	CLIP-seq
MIRT1493679	hsa-miR-1255a	CLIP-seq
MIRT1493680	hsa-miR-1255b	CLIP-seq
MIRT1493681	hsa-miR-1260	CLIP-seq
MIRT1493682	hsa-miR-1260b	CLIP-seq
MIRT1493683	hsa-miR-1280	CLIP-seq
MIRT1493684	hsa-miR-1304	CLIP-seq
MIRT1493685	hsa-miR-138	CLIP-seq
MIRT1493686	hsa-miR-1469	CLIP-seq
MIRT1493687	hsa-miR-1587	CLIP-seq
MIRT1493688	hsa-miR-15a	CLIP-seq
MIRT1493689	hsa-miR-15b	CLIP-seq
MIRT1493690	hsa-miR-16	CLIP-seq
MIRT1493691	hsa-miR-1827	CLIP-seq
MIRT1493692	hsa-miR-195	CLIP-seq
MIRT1493693	hsa-miR-2110	CLIP-seq
MIRT1493694	hsa-miR-2467-3p	CLIP-seq
MIRT1493695	hsa-miR-298	CLIP-seq
MIRT1493696	hsa-miR-3074-5p	CLIP-seq
MIRT1493697	hsa-miR-3143	CLIP-seq
MIRT1493698	hsa-miR-3144-5p	CLIP-seq
MIRT1493699	hsa-miR-3150a-3p	CLIP-seq
MIRT1493700	hsa-miR-3158-5p	CLIP-seq
MIRT1493701	hsa-miR-3179	CLIP-seq
MIRT1493702	hsa-miR-3186-5p	CLIP-seq
MIRT1493703	hsa-miR-3201	CLIP-seq
MIRT1493704	hsa-miR-3202	CLIP-seq
MIRT1493705	hsa-miR-339-5p	CLIP-seq
MIRT1493706	hsa-miR-3605-5p	CLIP-seq
MIRT1493707	hsa-miR-3652	CLIP-seq
MIRT1493708	hsa-miR-3681	CLIP-seq
MIRT1493709	hsa-miR-3936	CLIP-seq
MIRT1493710	hsa-miR-410	CLIP-seq
MIRT1493711	hsa-miR-424	CLIP-seq
MIRT1493712	hsa-miR-4417	CLIP-seq
MIRT1493713	hsa-miR-4430	CLIP-seq
MIRT1493714	hsa-miR-4450	CLIP-seq
MIRT1493715	hsa-miR-4456	CLIP-seq
MIRT1493716	hsa-miR-4492	CLIP-seq
MIRT1493717	hsa-miR-4498	CLIP-seq
MIRT1493718	hsa-miR-4505	CLIP-seq
MIRT1493719	hsa-miR-4520a-3p	CLIP-seq
MIRT1493720	hsa-miR-4520b-3p	CLIP-seq
MIRT1493721	hsa-miR-4524	CLIP-seq
MIRT1493722	hsa-miR-4651	CLIP-seq
MIRT1493723	hsa-miR-4656	CLIP-seq
MIRT1493724	hsa-miR-4675	CLIP-seq
MIRT1493725	hsa-miR-4680-3p	CLIP-seq
MIRT1493726	hsa-miR-4711-5p	CLIP-seq
MIRT1493727	hsa-miR-4741	CLIP-seq
MIRT1493728	hsa-miR-4764-3p	CLIP-seq
MIRT1493729	hsa-miR-4786-3p	CLIP-seq
MIRT1493730	hsa-miR-4791	CLIP-seq
MIRT1493731	hsa-miR-490-5p	CLIP-seq
MIRT1493732	hsa-miR-497	CLIP-seq
MIRT1493733	hsa-miR-503	CLIP-seq
MIRT1493734	hsa-miR-5095	CLIP-seq
MIRT1493735	hsa-miR-541	CLIP-seq
MIRT1493736	hsa-miR-543	CLIP-seq
MIRT1493737	hsa-miR-548aa	CLIP-seq
MIRT1493738	hsa-miR-600	CLIP-seq
MIRT1493739	hsa-miR-608	CLIP-seq
MIRT1493740	hsa-miR-646	CLIP-seq
MIRT1493741	hsa-miR-654-5p	CLIP-seq
MIRT1493742	hsa-miR-762	CLIP-seq
MIRT2148789	hsa-miR-1225-3p	CLIP-seq
MIRT1493688	hsa-miR-15a	CLIP-seq
MIRT1493689	hsa-miR-15b	CLIP-seq
MIRT1493690	hsa-miR-16	CLIP-seq
MIRT2148790	hsa-miR-1915	CLIP-seq
MIRT1493692	hsa-miR-195	CLIP-seq
MIRT2148791	hsa-miR-2355-5p	CLIP-seq
MIRT1493701	hsa-miR-3179	CLIP-seq
MIRT1493703	hsa-miR-3201	CLIP-seq
MIRT1493704	hsa-miR-3202	CLIP-seq
MIRT2148792	hsa-miR-3929	CLIP-seq
MIRT1493711	hsa-miR-424	CLIP-seq
MIRT2148793	hsa-miR-4270	CLIP-seq
MIRT2148794	hsa-miR-4313	CLIP-seq
MIRT2148795	hsa-miR-4419b	CLIP-seq
MIRT2148796	hsa-miR-4441	CLIP-seq
MIRT2148797	hsa-miR-4478	CLIP-seq
MIRT1493722	hsa-miR-4651	CLIP-seq
MIRT2148798	hsa-miR-4726-3p	CLIP-seq
MIRT2148799	hsa-miR-4758-3p	CLIP-seq
MIRT1493730	hsa-miR-4791	CLIP-seq
MIRT1493732	hsa-miR-497	CLIP-seq
MIRT1493739	hsa-miR-608	CLIP-seq
MIRT1493676	hsa-miR-103a	CLIP-seq
MIRT1493677	hsa-miR-107	CLIP-seq
MIRT1493688	hsa-miR-15a	CLIP-seq
MIRT1493689	hsa-miR-15b	CLIP-seq
MIRT1493690	hsa-miR-16	CLIP-seq
MIRT1493692	hsa-miR-195	CLIP-seq
MIRT2369181	hsa-miR-3117-5p	CLIP-seq
MIRT1493697	hsa-miR-3143	CLIP-seq
MIRT2369182	hsa-miR-3150b-3p	CLIP-seq
MIRT1493703	hsa-miR-3201	CLIP-seq
MIRT2369183	hsa-miR-3619-3p	CLIP-seq
MIRT1493708	hsa-miR-3681	CLIP-seq
MIRT2369184	hsa-miR-3925-3p	CLIP-seq
MIRT1493710	hsa-miR-410	CLIP-seq
MIRT1493711	hsa-miR-424	CLIP-seq
MIRT2369185	hsa-miR-4258	CLIP-seq
MIRT2369186	hsa-miR-4433	CLIP-seq
MIRT2369187	hsa-miR-4459	CLIP-seq
MIRT1493719	hsa-miR-4520a-3p	CLIP-seq
MIRT1493720	hsa-miR-4520b-3p	CLIP-seq
MIRT1493721	hsa-miR-4524	CLIP-seq
MIRT2369188	hsa-miR-4661-5p	CLIP-seq
MIRT2369189	hsa-miR-4704-5p	CLIP-seq
MIRT1493726	hsa-miR-4711-5p	CLIP-seq
MIRT1493728	hsa-miR-4764-3p	CLIP-seq
MIRT2369190	hsa-miR-4768-3p	CLIP-seq
MIRT2369191	hsa-miR-4784	CLIP-seq
MIRT1493730	hsa-miR-4791	CLIP-seq
MIRT1493732	hsa-miR-497	CLIP-seq
MIRT1493733	hsa-miR-503	CLIP-seq
MIRT2369192	hsa-miR-515-5p	CLIP-seq
MIRT1493736	hsa-miR-543	CLIP-seq
MIRT1493737	hsa-miR-548aa	CLIP-seq
MIRT1493740	hsa-miR-646	CLIP-seq
MIRT2369193	hsa-miR-766	CLIP-seq
MIRT2148789	hsa-miR-1225-3p	CLIP-seq
MIRT2397022	hsa-miR-1247	CLIP-seq
MIRT2397023	hsa-miR-198	CLIP-seq
MIRT2397024	hsa-miR-4685-5p	CLIP-seq
MIRT2397025	hsa-miR-939	CLIP-seq
MIRT2148789	hsa-miR-1225-3p	CLIP-seq
MIRT2463531	hsa-miR-1289	CLIP-seq
MIRT2148790	hsa-miR-1915	CLIP-seq
MIRT2463532	hsa-miR-3690	CLIP-seq
MIRT2463533	hsa-miR-370	CLIP-seq
MIRT2463534	hsa-miR-4254	CLIP-seq
MIRT2463535	hsa-miR-4323	CLIP-seq
MIRT2463536	hsa-miR-4476	CLIP-seq
MIRT2463537	hsa-miR-4533	CLIP-seq
MIRT2463538	hsa-miR-4633-3p	CLIP-seq
MIRT2463539	hsa-miR-4668-5p	CLIP-seq
MIRT2463540	hsa-miR-4749-3p	CLIP-seq
MIRT2148799	hsa-miR-4758-3p	CLIP-seq
MIRT2463541	hsa-miR-4793-5p	CLIP-seq
MIRT2662772	hsa-miR-1266	CLIP-seq
MIRT2148793	hsa-miR-4270	CLIP-seq
MIRT2148796	hsa-miR-4441	CLIP-seq
MIRT2662773	hsa-miR-4518	CLIP-seq
MIRT2662772	hsa-miR-1266	CLIP-seq
MIRT2148793	hsa-miR-4270	CLIP-seq
MIRT2148796	hsa-miR-4441	CLIP-seq
MIRT2662773	hsa-miR-4518	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOXQ1	Activation	20145154

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	20137080, 20412773
GO:0001947	Process	Heart looping	IEA
GO:0002092	Process	Positive regulation of receptor internalization	IDA	16890161
GO:0003136	Process	Negative regulation of heart induction by canonical Wnt signaling pathway	IDA	19736317
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0005102	Function	Signaling receptor binding	IPI	20093360
GO:0005109	Function	Frizzled binding	IBA	21873635
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	19072540, 20393562, 21944579, 22682250, 22726442, 22784633, 24768165
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	26902720
GO:0005615	Component	Extracellular space	ISS
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0007411	Process	Axon guidance	IEA
GO:0008283	Process	Cell population proliferation	IMP	26902720
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0009986	Component	Cell surface	ISS
GO:0010387	Process	COP9 signalosome assembly	ISS
GO:0010628	Process	Positive regulation of gene expression	IDA	26687115
GO:0010977	Process	Negative regulation of neuron projection development	ISS
GO:0016055	Process	Wnt signaling pathway	TAS
GO:0019904	Function	Protein domain specific binding	IEA
GO:0021527	Process	Spinal cord association neuron differentiation	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0021846	Process	Cell proliferation in forebrain	ISS
GO:0021874	Process	Wnt signaling pathway involved in forebrain neuroblast division	IEA
GO:0021904	Process	Dorsal/ventral neural tube patterning	IEA
GO:0030097	Process	Hemopoiesis	IEA
GO:0030182	Process	Neuron differentiation	IBA	21873635
GO:0030182	Process	Neuron differentiation	ISS
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030879	Process	Mammary gland development	IEA
GO:0030890	Process	Positive regulation of B cell proliferation	IEA
GO:0031901	Component	Early endosome membrane	TAS
GO:0032092	Process	Positive regulation of protein binding	IDA	16890161
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	20723538
GO:0033278	Process	Cell proliferation in midbrain	TAS	24431302
GO:0034613	Process	Cellular protein localization	IEA
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0036342	Process	Post-anal tail morphogenesis	IEA
GO:0036465	Process	Synaptic vesicle recycling	TAS	22988876
GO:0039706	Function	Co-receptor binding	IPI	20093360
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0043280	Process	Positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA
GO:0045165	Process	Cell fate commitment	IBA	21873635
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045893	Process	Positive regulation of transcription, DNA-templated	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20723538
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048018	Function	Receptor ligand activity	IDA	20723538, 28733458
GO:0048103	Process	Somatic stem cell division	IEA
GO:0048337	Process	Positive regulation of mesodermal cell fate specification	IDA	20559569
GO:0048343	Process	Paraxial mesodermal cell fate commitment	IEA
GO:0048643	Process	Positive regulation of skeletal muscle tissue development	IEA
GO:0048697	Process	Positive regulation of collateral sprouting in absence of injury	IEA
GO:0048843	Process	Negative regulation of axon extension involved in axon guidance	IEA
GO:0050768	Process	Negative regulation of neurogenesis	ISS
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050807	Process	Regulation of synapse organization	IDA	18986540
GO:0050807	Process	Regulation of synapse organization	IMP	18986540
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA	21873635
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	18941195, 19101069, 20137080, 20723538, 23797875, 28733458
GO:0060070	Process	Canonical Wnt signaling pathway	IMP	26902720
GO:0061098	Process	Positive regulation of protein tyrosine kinase activity	IEA
GO:0061184	Process	Positive regulation of dermatome development	IDA	10654605
GO:0061317	Process	Canonical Wnt signaling pathway involved in cardiac muscle cell fate commitment	IDA	20559569
GO:0062009	Process	Secondary palate development	IMP	18413325
GO:0070062	Component	Extracellular exosome	TAS
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IEA
GO:0070527	Process	Platelet aggregation	IEA
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0090245	Process	Axis elongation involved in somitogenesis	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IDA	20137080, 20723538
GO:0090676	Process	Calcium ion transmembrane transport via low voltage-gated calcium channel	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IDA	18986540
GO:0098978	Component	Glutamatergic synapse	IMP	18986540
GO:0099054	Process	Presynapse assembly	TAS	24449494
GO:0099527	Process	Postsynapse to nucleus signaling pathway	IEA
GO:1901215	Process	Negative regulation of neuron death	IEA
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IEA
GO:1904339	Process	Negative regulation of dopaminergic neuron differentiation	IEA
GO:1904798	Process	Positive regulation of core promoter binding	IEA
GO:1904886	Process	Beta-catenin destruction complex disassembly	TAS
GO:1904953	Process	Wnt signaling pathway involved in midbrain dopaminergic neuron differentiation	TAS	22988876
GO:1905606	Process	Regulation of presynapse assembly	IDA	19883499
GO:1905606	Process	Regulation of presynapse assembly	IMP	19883499
GO:1990851	Component	Wnt-Frizzled-LRP5/6 complex	IDA	20093360
GO:2000049	Process	Positive regulation of cell-cell adhesion mediated by cadherin	IEA
GO:2000081	Process	Positive regulation of canonical Wnt signaling pathway involved in controlling type B pancreatic cell proliferation	IEA
GO:2000179	Process	Positive regulation of neural precursor cell proliferation	IEA
GO:2000347	Process	Positive regulation of hepatocyte proliferation	IEA
GO:2000727	Process	Positive regulation of cardiac muscle cell differentiation	IDA	20559569

Other IDs

• MIM: 606359
• HGNC: 15983
• e!Ensembl: ENSG00000154342

Protein

• UniProt ID: P56704
• Protein name: Protein Wnt-3a
• Protein function: Ligand for members of the frizzled family of seven transmembrane receptors (Probable). Functions in the canonical Wnt signaling pathway that results in activation of transcription factors of the TCF/LEF family (PubMed:20093360, PubMed:21244856,
• PDB: 7DRT, 7URD, 7URE, 8TZR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00110	wnt	44 → 352	wnt family	Family

• Sequence:

  MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYV
  EIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGV
  AFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDAR
  SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
  MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
  SHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK

• Sequence length: 352

Pathways

KEGG:

mTOR signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Cushing syndrome
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Human papillomavirus infection
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Reactome:

TCF dependent signaling in response to WNT
WNT ligand biogenesis and trafficking
Disassembly of the destruction complex and recruitment of AXIN to the membrane
Regulation of FZD by ubiquitination
RNF mutants show enhanced WNT signaling and proliferation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Hirschsprung disease	Hirschsprung Disease	rs104893891, rs76262710, rs75075748, rs75996173, rs79014735, rs77316810, rs75076352, rs76087194, rs76534745, rs76764689, rs76449634, rs78098482, rs79661516, rs104894389, rs769735757, rs267606780, rs1568823467, rs377767412, rs193922699, rs75030001, rs606231342, rs1553540620, rs759944122, rs1057519322, rs1057519323, rs1057519052, rs1588873476, rs1588866040, rs1838178869	24817932
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	28242765
Osteoporosis	Osteoporosis, Juvenile osteoporosis, Idiopathic juvenile osteoporosis	rs72658152, rs72667023, rs587776916, rs72656370, rs768615287	22789636