GediPNet logo

PHOX2B (paired like homeobox 2B)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8929
Gene nameGene Name - the full gene name approved by the HGNC.
Paired like homeobox 2B
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
PHOX2B
SynonymsGene synonyms aliases
CCHS, NBLST2, NBPhox, PMX2B
ChromosomeChromosome number
4
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p13
SummarySummary of gene provided in NCBI Entrez Gene.
The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription factor involved in the development of several major noradrenergic neuron populations a
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs17879189 TGCCGCCGCCGCCGCTGCCGC>-,TGCCGCCGCCGCCGCTGCCGCTGCCGCCGCCGCCGCTGCCGC Pathogenic, benign, likely-benign Inframe insertion, coding sequence variant, inframe deletion
rs104893856 C>T Risk-factor Missense variant, coding sequence variant
rs587776626 G>-,GG Pathogenic, likely-pathogenic Frameshift variant, coding sequence variant
rs761018157 TGCCGCTGCCGCCGC>-,TGCCGCTGCCGCCGCTGCCGCTGCCGCCGC Pathogenic, likely-benign, benign Coding sequence variant, inframe insertion, inframe deletion
rs772448418 CGCGGCCGCCGCCGCTGCTGC>-,CGCGGCCGCCGCCGCTGCTGCCGCGGCCGCCGCCGCTGCTGC Uncertain-significance, pathogenic Coding sequence variant, inframe deletion, inframe insertion
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT535286 hsa-miR-4262 PAR-CLIP 22012620
MIRT535285 hsa-miR-181b-5p PAR-CLIP 22012620
MIRT535284 hsa-miR-181a-5p PAR-CLIP 22012620
MIRT535283 hsa-miR-181c-5p PAR-CLIP 22012620
MIRT535282 hsa-miR-181d-5p PAR-CLIP 22012620
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IDA 16280598
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA 21873635
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 16280598
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 16144830
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q99453
Protein name Paired mesoderm homeobox protein 2B (Neuroblastoma Phox) (NBPhox) (PHOX2B homeodomain protein) (Paired-like homeobox 2B)
Protein function Involved in the development of several major noradrenergic neuron populations, including the locus coeruleus. Transcription factor which could determine a neurotransmitter phenotype in vertebrates. Enhances second-messenger-mediated activation o
PDB 7MJA , 8EK5 , 8P7G , 8PTL , 8PUI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain
99 155
Homeodomain
Domain
Sequence
MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSL
TPGSCSLGTLRDHQSSPYAAVPYKLFTDHGGLNEKRKQRRIRTTFTSAQLKELERVFAET
HYPDIYTREELALKIDLTEARVQVWFQNRRAKFRK
QERAAAAAAAAAKNGSSGKKSDSSR
DDESKEAKSTDPDSTGGPGPNPNPTPSCGANGGGGGGPSPAGAPGAAGPGGPGGEPGKGG
AAAAAAAAAAAAAAAAAAAAGGLAAAGGPGQGWAPGPGPITSIPDSLGGPFASVLSSLQR
PNGAKAALVKSSMF
Sequence length 314
Interactions View interactions
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Congenital central hypoventilation Congenital central hypoventilation rs587776626, rs1733878065, rs761018157, rs779557320, rs772448418, rs775006915, rs1733941453, rs73810366 14608649, 14566559, 12640453, 16691592, 15657873, 20208042, 26063465, 15334515, 15024693
Dysautonomia Dysautonomia rs111033171, rs137853022, rs28939712, rs754348901, rs749052963, rs1057517169, rs1057516865, rs763445509, rs767527819, rs781333644, rs1239081703, rs1554696574, rs539544212, rs1201626345, rs774890086, rs1554703061, rs1554703613, rs1319053366, rs1554703851, rs868073099, rs926177767, rs376078668, rs1554695299, rs1554696648, rs1554696934, rs1554699327, rs1554691572, rs1554695846, rs1554697001, rs770668926, rs1554698037, rs759412460, rs1554702142, rs765572951, rs1554702880, rs1554703831, rs760774999, rs1554696650, rs757972943, rs1554703874, rs1554703907, rs571348995
Haddad syndrome CCHS WITH HIRSCHSPRUNG DISEASE, Haddad syndrome rs1297909281, rs587776626, rs1733941453, rs73810366 14608649, 12640453
Hearing loss Sensorineural Hearing Loss (disorder) rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359, rs180177151, rs180177154, rs180177153, rs35689081, rs35887622, rs80338944, rs104894396, rs104894398, rs80338947, rs80338948, rs80338942, rs104894402, rs104894403, rs80338945, rs28931594, rs80338940, rs80338941, rs80356590, rs80338950, rs387906706, rs387906707, rs387906708, rs398122848, rs387907016, rs587776894, rs387907088, rs397515411, rs370965183, rs398122930, rs199897298, rs111033187, rs111033448, rs199606180, rs111033284, rs397516413, rs111033305, rs111033220, rs111033256, rs111033297, rs111033253, rs104894408, rs111033295, rs397516874, rs76434661, rs111033335, rs397517323, rs111033247, rs367928692, rs374793617, rs143939430, rs397515605, rs80338939, rs200656442, rs779748859, rs587781261, rs587781262, rs143343083, rs200147906, rs730880338, rs797044491, rs146281367, rs756484720, rs869025593, rs201306709, rs540895576, rs777777359, rs879255246, rs1554358720, rs142498437, rs377145777, rs1057517519, rs779077039, rs952741388, rs1060499797, rs764139009, rs1060499590, rs1064794012, rs1064797115, rs756790858, rs775633137, rs1554952443, rs1554952193, rs782063761, rs1199012623, rs756147087, rs1555648043, rs1555661490, rs1553196233, rs781546107, rs111033190, rs775428246, rs782539587, rs537227442, rs148695069, rs1554835827, rs953422571, rs1554834186, rs1554834161, rs1554835103, rs1554577339, rs1554577402, rs768471577, rs782279338, rs781951909, rs998045226, rs375759781, rs755804651, rs1557458426, rs767797828, rs538027448, rs1559366084, rs367688416, rs1558480402, rs1558490542, rs1559870857, rs1560690591, rs1561299289, rs1562817224, rs1562817529, rs1562822565, rs1562835391, rs1564113368, rs1564554255, rs773851192, rs1564555240, rs761261855, rs1564805114, rs1565522273, rs1565127413, rs781790246, rs1565430886, rs1565469959, rs746667217, rs1565819402, rs1565855932, rs150529554, rs1567939793, rs201866631, rs754472294, rs1559372512, rs1558464965, rs1558488902, rs775062249, rs1226171550, rs1561590396, rs765574676, rs762876554, rs757327146, rs1564949059, rs1565519673, rs368050948, rs1565541888, rs781989117, rs1565402473, rs750358148, rs1386887007, rs1209665716, rs1567641234, rs1237955948, rs1569042782, rs752672077, rs146689036, rs1560070780, rs149712664, rs1564556995, rs762226905, rs773573968, rs1568528171, rs1198256157, rs377267777, rs370564476, rs1577876794, rs747787770, rs759432278, rs1043716893, rs1581138934, rs2033773650, rs1421964916, rs771766431, rs780917129, rs1895773215, rs1895769400, rs761543680, rs1565920060
Unknown
Disease name Disease term dbSNP ID References
Cardiovascular abnormalities Cardiovascular Abnormalities
Crohn disease Crohn Disease, Regional enteritis rs2066847, rs2066844, rs886052047, rs5743265, rs111608429, rs104895438 17435756
Crohn`s disease of large bowel Crohn`s disease of large bowel 17435756
Crohn`s disease of the ileum Crohn`s disease of the ileum 17435756

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412