GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

CCNB1 (cyclin B1)

Gene

891

Cyclin B1

CCNB1

CCNB

5q13.2

The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The encoded protein is necessary for proper control of the G2/M transition phase of the

Show/Hide all(249)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021866	hsa-miR-132-3p	Western blot;qRT-PCR	21329664
MIRT024969	hsa-miR-212-3p	Western blot;qRT-PCR	21329664
MIRT030588	hsa-miR-24-3p	Microarray	19748357
MIRT051879	hsa-let-7b-5p	CLASH	23622248
MIRT050578	hsa-miR-20a-5p	CLASH	23622248
MIRT049477	hsa-miR-92a-3p	CLASH	23622248
MIRT047127	hsa-miR-183-5p	CLASH	23622248
MIRT054743	hsa-miR-548b-3p	Luciferase reporter assay, Immunofluorescence analysis, qRT-PCR	24832599
MIRT054743	hsa-miR-548b-3p	Luciferase reporter assay, Immunofluorescence analysis, qRT-PCR	24832599
MIRT704898	hsa-miR-6089	HITS-CLIP	23313552
MIRT704897	hsa-miR-6134	HITS-CLIP	23313552
MIRT704896	hsa-miR-4649-5p	HITS-CLIP	23313552
MIRT704895	hsa-miR-6729-5p	HITS-CLIP	23313552
MIRT704894	hsa-miR-541-3p	HITS-CLIP	23313552
MIRT704893	hsa-miR-654-5p	HITS-CLIP	23313552
MIRT688795	hsa-miR-1910-3p	HITS-CLIP	23313552
MIRT688794	hsa-miR-6511a-5p	HITS-CLIP	23313552
MIRT688793	hsa-miR-4257	HITS-CLIP	23313552
MIRT688792	hsa-miR-3192-5p	HITS-CLIP	23313552
MIRT688791	hsa-miR-3160-3p	HITS-CLIP	23313552
MIRT688790	hsa-miR-558	HITS-CLIP	23313552
MIRT688789	hsa-miR-4487	HITS-CLIP	23313552
MIRT688788	hsa-miR-377-5p	HITS-CLIP	23313552
MIRT688787	hsa-miR-6086	HITS-CLIP	23313552
MIRT688786	hsa-miR-2467-3p	HITS-CLIP	23313552
MIRT688785	hsa-miR-6499-3p	HITS-CLIP	23313552
MIRT688784	hsa-miR-3612	HITS-CLIP	23313552
MIRT688783	hsa-miR-650	HITS-CLIP	23313552
MIRT688782	hsa-miR-455-3p	HITS-CLIP	23313552
MIRT688781	hsa-miR-6516-5p	HITS-CLIP	23313552
MIRT314110	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT314112	hsa-miR-3145-5p	PAR-CLIP	20371350
MIRT568135	hsa-miR-508-5p	PAR-CLIP	20371350
MIRT568134	hsa-miR-1278	PAR-CLIP	20371350
MIRT359007	hsa-miR-192-3p	PAR-CLIP	20371350
MIRT314110	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT314112	hsa-miR-3145-5p	PAR-CLIP	20371350
MIRT568135	hsa-miR-508-5p	PAR-CLIP	20371350
MIRT568134	hsa-miR-1278	PAR-CLIP	20371350
MIRT359007	hsa-miR-192-3p	PAR-CLIP	20371350
MIRT047127	hsa-miR-183-5p	PAR-CLIP	20371350
MIRT216352	hsa-miR-548n	PAR-CLIP	20371350
MIRT216348	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT216358	hsa-miR-548ab	PAR-CLIP	20371350
MIRT216359	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT216360	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT216361	hsa-miR-548ak	PAR-CLIP	20371350
MIRT216363	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT216365	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT216366	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT216367	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT216368	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT216370	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT216371	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT216347	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT216372	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT216349	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT216350	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT216353	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT216354	hsa-miR-548i	PAR-CLIP	20371350
MIRT216351	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT216357	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT216355	hsa-miR-548w	PAR-CLIP	20371350
MIRT216356	hsa-miR-548y	PAR-CLIP	20371350
MIRT216346	hsa-miR-559	PAR-CLIP	20371350
MIRT216362	hsa-miR-4517	PAR-CLIP	20371350
MIRT216369	hsa-miR-5583-3p	PAR-CLIP	20371350
MIRT359013	hsa-miR-5683	PAR-CLIP	20371350
MIRT216364	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT359012	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT532068	hsa-miR-4477a	PAR-CLIP	20371350
MIRT359005	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT359008	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT359014	hsa-miR-6762-5p	PAR-CLIP	20371350
MIRT359015	hsa-miR-6845-5p	PAR-CLIP	20371350
MIRT314136	hsa-miR-3163	PAR-CLIP	20371350
MIRT359014	hsa-miR-6762-5p	PAR-CLIP	20371350
MIRT359015	hsa-miR-6845-5p	PAR-CLIP	20371350
MIRT216352	hsa-miR-548n	PAR-CLIP	22012620
MIRT532070	hsa-miR-548az-5p	PAR-CLIP	22012620
MIRT532069	hsa-miR-548t-5p	PAR-CLIP	22012620
MIRT216348	hsa-miR-548a-5p	PAR-CLIP	22012620
MIRT216358	hsa-miR-548ab	PAR-CLIP	22012620
MIRT216359	hsa-miR-548ad-5p	PAR-CLIP	22012620
MIRT216360	hsa-miR-548ae-5p	PAR-CLIP	22012620
MIRT216361	hsa-miR-548ak	PAR-CLIP	22012620
MIRT216363	hsa-miR-548am-5p	PAR-CLIP	22012620
MIRT216365	hsa-miR-548ap-5p	PAR-CLIP	22012620
MIRT216366	hsa-miR-548aq-5p	PAR-CLIP	22012620
MIRT216367	hsa-miR-548ar-5p	PAR-CLIP	22012620
MIRT216368	hsa-miR-548as-5p	PAR-CLIP	22012620
MIRT216370	hsa-miR-548au-5p	PAR-CLIP	22012620
MIRT216371	hsa-miR-548ay-5p	PAR-CLIP	22012620
MIRT216347	hsa-miR-548b-5p	PAR-CLIP	22012620
MIRT216372	hsa-miR-548bb-5p	PAR-CLIP	22012620
MIRT216349	hsa-miR-548c-5p	PAR-CLIP	22012620
MIRT216350	hsa-miR-548d-5p	PAR-CLIP	22012620
MIRT216353	hsa-miR-548h-5p	PAR-CLIP	22012620
MIRT216354	hsa-miR-548i	PAR-CLIP	22012620
MIRT216351	hsa-miR-548j-5p	PAR-CLIP	22012620
MIRT216357	hsa-miR-548o-5p	PAR-CLIP	22012620
MIRT216355	hsa-miR-548w	PAR-CLIP	22012620
MIRT216356	hsa-miR-548y	PAR-CLIP	22012620
MIRT216346	hsa-miR-559	PAR-CLIP	22012620
MIRT216362	hsa-miR-4517	PAR-CLIP	22012620
MIRT216369	hsa-miR-5583-3p	PAR-CLIP	22012620
MIRT359013	hsa-miR-5683	PAR-CLIP	22012620
MIRT216364	hsa-miR-4709-5p	PAR-CLIP	22012620
MIRT532068	hsa-miR-4477a	PAR-CLIP	22012620
MIRT359005	hsa-let-7a-2-3p	PAR-CLIP	22012620
MIRT359008	hsa-let-7g-3p	PAR-CLIP	22012620
MIRT688791	hsa-miR-3160-3p	PAR-CLIP	26701625
MIRT688791	hsa-miR-3160-3p	PAR-CLIP	26701625
MIRT688791	hsa-miR-3160-3p	PAR-CLIP	26701625
MIRT688789	hsa-miR-4487	PAR-CLIP	26701625
MIRT688789	hsa-miR-4487	PAR-CLIP	26701625
MIRT688789	hsa-miR-4487	PAR-CLIP	26701625
MIRT568135	hsa-miR-508-5p	PAR-CLIP	26701625
MIRT568135	hsa-miR-508-5p	PAR-CLIP	26701625
MIRT568135	hsa-miR-508-5p	PAR-CLIP	26701625
MIRT688790	hsa-miR-558	PAR-CLIP	26701625
MIRT688790	hsa-miR-558	PAR-CLIP	26701625
MIRT688790	hsa-miR-558	PAR-CLIP	26701625
MIRT049477	hsa-miR-92a-3p	PAR-CLIP	26701625
MIRT049477	hsa-miR-92a-3p	PAR-CLIP	26701625
MIRT049477	hsa-miR-92a-3p	PAR-CLIP	26701625
MIRT732757	hsa-miR-125b-5p	Luciferase reporter assay, Western blotting	33859745
MIRT732822	hsa-miR-183-3p	Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	31605132
MIRT704898	hsa-miR-6089	HITS-CLIP	23313552
MIRT704897	hsa-miR-6134	HITS-CLIP	23313552
MIRT704896	hsa-miR-4649-5p	HITS-CLIP	23313552
MIRT704895	hsa-miR-6729-5p	HITS-CLIP	23313552
MIRT704894	hsa-miR-541-3p	HITS-CLIP	23313552
MIRT704893	hsa-miR-654-5p	HITS-CLIP	23313552
MIRT688795	hsa-miR-1910-3p	HITS-CLIP	23313552
MIRT688794	hsa-miR-6511a-5p	HITS-CLIP	23313552
MIRT688793	hsa-miR-4257	HITS-CLIP	23313552
MIRT688792	hsa-miR-3192-5p	HITS-CLIP	23313552
MIRT688791	hsa-miR-3160-3p	HITS-CLIP	23313552
MIRT688790	hsa-miR-558	HITS-CLIP	23313552
MIRT688789	hsa-miR-4487	HITS-CLIP	23313552
MIRT688788	hsa-miR-377-5p	HITS-CLIP	23313552
MIRT688787	hsa-miR-6086	HITS-CLIP	23313552
MIRT688786	hsa-miR-2467-3p	HITS-CLIP	23313552
MIRT688785	hsa-miR-6499-3p	HITS-CLIP	23313552
MIRT688784	hsa-miR-3612	HITS-CLIP	23313552
MIRT688783	hsa-miR-650	HITS-CLIP	23313552
MIRT688782	hsa-miR-455-3p	HITS-CLIP	23313552
MIRT688781	hsa-miR-6516-5p	HITS-CLIP	23313552
MIRT314110	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT314112	hsa-miR-3145-5p	PAR-CLIP	20371350
MIRT568135	hsa-miR-508-5p	PAR-CLIP	20371350
MIRT568134	hsa-miR-1278	PAR-CLIP	20371350
MIRT359007	hsa-miR-192-3p	PAR-CLIP	20371350
MIRT314110	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT314112	hsa-miR-3145-5p	PAR-CLIP	20371350
MIRT568135	hsa-miR-508-5p	PAR-CLIP	20371350
MIRT568134	hsa-miR-1278	PAR-CLIP	20371350
MIRT359007	hsa-miR-192-3p	PAR-CLIP	20371350
MIRT047127	hsa-miR-183-5p	PAR-CLIP	20371350
MIRT216352	hsa-miR-548n	PAR-CLIP	20371350
MIRT216348	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT216358	hsa-miR-548ab	PAR-CLIP	20371350
MIRT216359	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT216360	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT216361	hsa-miR-548ak	PAR-CLIP	20371350
MIRT216363	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT216365	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT216366	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT216367	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT216368	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT216370	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT216371	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT216347	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT216372	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT216349	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT216350	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT216353	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT216354	hsa-miR-548i	PAR-CLIP	20371350
MIRT216351	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT216357	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT216355	hsa-miR-548w	PAR-CLIP	20371350
MIRT216356	hsa-miR-548y	PAR-CLIP	20371350
MIRT216346	hsa-miR-559	PAR-CLIP	20371350
MIRT216362	hsa-miR-4517	PAR-CLIP	20371350
MIRT216369	hsa-miR-5583-3p	PAR-CLIP	20371350
MIRT359013	hsa-miR-5683	PAR-CLIP	20371350
MIRT216364	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT359012	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT532068	hsa-miR-4477a	PAR-CLIP	20371350
MIRT359005	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT359008	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT359014	hsa-miR-6762-5p	PAR-CLIP	20371350
MIRT359015	hsa-miR-6845-5p	PAR-CLIP	20371350
MIRT314136	hsa-miR-3163	PAR-CLIP	20371350
MIRT359014	hsa-miR-6762-5p	PAR-CLIP	20371350
MIRT359015	hsa-miR-6845-5p	PAR-CLIP	20371350
MIRT216352	hsa-miR-548n	PAR-CLIP	22012620
MIRT532070	hsa-miR-548az-5p	PAR-CLIP	22012620
MIRT532069	hsa-miR-548t-5p	PAR-CLIP	22012620
MIRT216348	hsa-miR-548a-5p	PAR-CLIP	22012620
MIRT216358	hsa-miR-548ab	PAR-CLIP	22012620
MIRT216359	hsa-miR-548ad-5p	PAR-CLIP	22012620
MIRT216360	hsa-miR-548ae-5p	PAR-CLIP	22012620
MIRT216361	hsa-miR-548ak	PAR-CLIP	22012620
MIRT216363	hsa-miR-548am-5p	PAR-CLIP	22012620
MIRT216365	hsa-miR-548ap-5p	PAR-CLIP	22012620
MIRT216366	hsa-miR-548aq-5p	PAR-CLIP	22012620
MIRT216367	hsa-miR-548ar-5p	PAR-CLIP	22012620
MIRT216368	hsa-miR-548as-5p	PAR-CLIP	22012620
MIRT216370	hsa-miR-548au-5p	PAR-CLIP	22012620
MIRT216371	hsa-miR-548ay-5p	PAR-CLIP	22012620
MIRT216347	hsa-miR-548b-5p	PAR-CLIP	22012620
MIRT216372	hsa-miR-548bb-5p	PAR-CLIP	22012620
MIRT216349	hsa-miR-548c-5p	PAR-CLIP	22012620
MIRT216350	hsa-miR-548d-5p	PAR-CLIP	22012620
MIRT216353	hsa-miR-548h-5p	PAR-CLIP	22012620
MIRT216354	hsa-miR-548i	PAR-CLIP	22012620
MIRT216351	hsa-miR-548j-5p	PAR-CLIP	22012620
MIRT216357	hsa-miR-548o-5p	PAR-CLIP	22012620
MIRT216355	hsa-miR-548w	PAR-CLIP	22012620
MIRT216356	hsa-miR-548y	PAR-CLIP	22012620
MIRT216346	hsa-miR-559	PAR-CLIP	22012620
MIRT216362	hsa-miR-4517	PAR-CLIP	22012620
MIRT216369	hsa-miR-5583-3p	PAR-CLIP	22012620
MIRT359013	hsa-miR-5683	PAR-CLIP	22012620
MIRT216364	hsa-miR-4709-5p	PAR-CLIP	22012620
MIRT532068	hsa-miR-4477a	PAR-CLIP	22012620
MIRT359005	hsa-let-7a-2-3p	PAR-CLIP	22012620
MIRT359008	hsa-let-7g-3p	PAR-CLIP	22012620
MIRT755571	hsa-miR-449a	Western blotting	36545680
MIRT755878	hsa-miR?139-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35181869
MIRT871220	hsa-miR-1305	CLIP-seq
MIRT871221	hsa-miR-183	CLIP-seq
MIRT871222	hsa-miR-3609	CLIP-seq
MIRT871223	hsa-miR-3973	CLIP-seq
MIRT871224	hsa-miR-4699-5p	CLIP-seq
MIRT871225	hsa-miR-4709-3p	CLIP-seq
MIRT871226	hsa-miR-4717-3p	CLIP-seq
MIRT871227	hsa-miR-520g	CLIP-seq
MIRT871228	hsa-miR-520h	CLIP-seq
MIRT871229	hsa-miR-548ah	CLIP-seq
MIRT871230	hsa-miR-548h	CLIP-seq
MIRT871231	hsa-miR-548j	CLIP-seq
MIRT871232	hsa-miR-548t	CLIP-seq
MIRT871233	hsa-miR-561	CLIP-seq
MIRT871234	hsa-miR-607	CLIP-seq
MIRT2385709	hsa-miR-3671	CLIP-seq
MIRT871234	hsa-miR-607	CLIP-seq

Transcription factors

Show/Hide all(19)

Transcription factor	Regulation	Reference
BRCA1	Unknown	12647291
E2F1	Unknown	22508987
E2F3	Unknown	17098936
E2F4	Unknown	22508987
FOXM1	Activation	19276163
IRF1	Repression	22200613
KLF4	Repression	14627709
KLF5	Activation	21951574
MYC	Unknown	11522645
NFKB1	Activation	11861406
NFKB1	Unknown	19610058
PTTG1	Activation	22475756
RELA	Activation	11861406
RELA	Unknown	19610058
TBP	Unknown	17098936
TFAP2A	Unknown	7739559
TP53	Repression	11892838
USF1	Unknown	10548544
YBX1	Repression	20596676

Show/Hide all(64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	IBA	21873635
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IBA	21873635
GO:0000922	Component	Spindle pole	IDA	18195732
GO:0000942	Component	Condensed nuclear chromosome outer kinetochore	IDA	18195732
GO:0001556	Process	Oocyte maturation	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001933	Process	Negative regulation of protein phosphorylation	IEA
GO:0005113	Function	Patched binding	IPI	11331587
GO:0005515	Function	Protein binding	IPI	8756624, 9001210, 10373560, 12612082, 15790566, 17283331, 18337751, 18408765, 19502428, 19879842, 20965177, 21540187, 21952639, 23397142, 23602568, 23799914, 24358021, 25241761, 25852190, 26496610, 27626412, 28514442, 30833792, 33037310
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	11331587, 16109376, 20725088
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	11331587, 17850284, 20725088
GO:0005759	Component	Mitochondrial matrix	IBA	21873635
GO:0005759	Component	Mitochondrial matrix	IDA	24746669
GO:0005813	Component	Centrosome	IBA	21873635
GO:0005813	Component	Centrosome	IDA	12524548
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	TAS
GO:0006977	Process	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS
GO:0007052	Process	Mitotic spindle organization	IMP	18195732
GO:0007077	Process	Mitotic nuclear envelope disassembly	TAS
GO:0007080	Process	Mitotic metaphase plate congression	IBA	21873635
GO:0007080	Process	Mitotic metaphase plate congression	IMP	18195732
GO:0007283	Process	Spermatogenesis	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IDA	24746669
GO:0016020	Component	Membrane	IEA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA	21873635
GO:0019901	Function	Protein kinase binding	IPI	12524548, 24746669
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031442	Process	Positive regulation of mRNA 3'-end processing	IEA
GO:0033129	Process	Positive regulation of histone phosphorylation	IEA
GO:0042246	Process	Tissue regeneration	IEA
GO:0042493	Process	Response to drug	IEA
GO:0044389	Function	Ubiquitin-like protein ligase binding	IPI	15749827
GO:0044772	Process	Mitotic cell cycle phase transition	IBA	21873635
GO:0045737	Process	Positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0045931	Process	Positive regulation of mitotic cell cycle	IMP	18195732
GO:0046680	Process	Response to DDT	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048565	Process	Digestive tract development	IEA
GO:0051301	Process	Cell division	IEA
GO:0051726	Process	Regulation of cell cycle	TAS
GO:0051987	Process	Positive regulation of attachment of spindle microtubules to kinetochore	IMP	18195732
GO:0055015	Process	Ventricular cardiac muscle cell development	IEA
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IEA
GO:0060623	Process	Regulation of chromosome condensation	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IDA	24746669
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0071283	Process	Cellular response to iron(III) ion	IEA
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0071407	Process	Cellular response to organic cyclic compound	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0090266	Process	Regulation of mitotic cell cycle spindle assembly checkpoint	IMP	18195732
GO:0097125	Component	Cyclin B1-CDK1 complex	IBA	21873635
GO:0097125	Component	Cyclin B1-CDK1 complex	IDA	24746669
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1905448	Process	Positive regulation of mitochondrial ATP synthesis coupled electron transport	IDA	24746669
GO:2000775	Process	Histone H3-S10 phosphorylation involved in chromosome condensation	IEA

MIM	HGNC	e!Ensembl
123836	1579	ENSG00000134057

Protein

UniProt ID

P14635

Protein name

G2/mitotic-specific cyclin-B1

Protein function

Essential for the control of the cell cycle at the G2/M (mitosis) transition.

PDB

2B9R , 2JGZ , 4Y72 , 4YC3 , 5HQ0 , 5LQF , 6GU2 , 6GU3 , 6GU4 , 7NJ0 , 8TAR , 8TAU , 9FH9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00134	Cyclin_N	173 → 298	Cyclin, N-terminal domain	Domain
PF02984	Cyclin_C	300 → 418	Cyclin, C-terminal domain	Domain

Sequence

MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKM
PMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI
LVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ
LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVP
KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP
LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE
WTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS
ALVQDLAKAVAKV

Sequence length

433

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway Cell cycle Oocyte meiosis p53 signaling pathway Cellular senescence Progesterone-mediated oocyte maturation Human immunodeficiency virus 1 infection		Polo-like kinase mediated events APC/C:Cdc20 mediated degradation of Cyclin B Regulation of APC/C activators between G1/S and early anaphase Phosphorylation of the APC/C Phosphorylation of Emi1 Condensation of Prophase Chromosomes Resolution of Sister Chromatid Cohesion Regulation of PLK1 Activity at G2/M Transition Activation of NIMA Kinases NEK9, NEK6, NEK7 Initiation of Nuclear Envelope (NE) Reformation Nuclear Pore Complex (NPC) Disassembly Depolymerisation of the Nuclear Lamina TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest Mitotic Prophase Cyclin A/B1/B2 associated events during G2/M transition G2/M DNA replication checkpoint Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex The role of GTSE1 in G2/M progression after G2 checkpoint Transcriptional regulation by RUNX2

Associated diseases

Show/Hide Causal Diseases (1)

Causal
Disease name	Disease term	dbSNP ID	References
Carcinoma of the head and neck	Squamous cell carcinoma of the head and neck	rs121909237, rs121909250, rs121909251, rs121909252, rs28934571, rs28934574, rs28934576, rs28934578, rs121912664, rs397516436, rs121912666, rs397514495, rs587782705, rs193920774, rs730882001, rs786201838, rs587782144, rs866775781, rs730882008, rs1567549584, rs1597371666, rs1597365075	29464035

Show/Hide Unknown Diseases (3)

Unknown
Disease name	Disease term	dbSNP ID	References
Liver carcinoma	Liver carcinoma		28284560
Sclerocystic ovaries	Sclerocystic Ovaries		21411543
Polycystic ovary syndrome	Polycystic Ovary Syndrome		21411543

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412