GediPNet logo

IER3 (immediate early response 3)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8870
Gene nameGene Name - the full gene name approved by the HGNC.
Immediate early response 3
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
IER3
SynonymsGene synonyms aliases
DIF-2, DIF2, GLY96, IEX-1, IEX-1L, IEX1, PRG1
ChromosomeChromosome number
6
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.33
SummarySummary of gene provided in NCBI Entrez Gene.
This gene functions in the protection of cells from Fas- or tumor necrosis factor type alpha-induced apoptosis. Partially degraded and unspliced transcripts are found after virus infection in vitro, but these transcripts are not found in vivo and do not g
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004200 hsa-miR-197-3p Microarray 16822819
MIRT027607 hsa-miR-98-5p Microarray 19088304
MIRT722053 hsa-miR-499b-5p HITS-CLIP 19536157
MIRT722052 hsa-miR-6729-3p HITS-CLIP 19536157
MIRT722050 hsa-miR-7977 HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
HOXA1 Unknown 17213808
MYC Unknown 12360408
NFKB1 Unknown 12360408
REL Unknown 12360408
RELA Unknown 12360408
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15451437, 16456541, 18191642, 32296183
GO:0005634 Component Nucleus IBA 21873635
GO:0005634 Component Nucleus IDA 20467439
GO:0005829 Component Cytosol TAS
GO:0006915 Process Apoptotic process TAS 9196025
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P46695
Protein name Radiation-inducible immediate-early gene IEX-1 (Differentiation-dependent gene 2 protein) (Protein DIF-2) (Immediate early protein GLY96) (Immediate early response 3 protein) (PACAP-responsive gene 1 protein) (Protein PRG1)
Protein function May play a role in the ERK signaling pathway by inhibiting the dephosphorylation of ERK by phosphatase PP2A-PPP2R5C holoenzyme. Also acts as an ERK downstream effector mediating survival. As a member of the NUPR1/RELB/IER3 survival pathway, may
Family and domains
Sequence
MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRK
RSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASL
APTPVSAVLEPFNLTSEPSDYALDLSTFLQQHPAAF
Sequence length 156
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
Reactome
    PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Dermatitis Dermatitis, Irritant rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 27258892
Hypertension Hypertensive disease rs13306026, rs13333226 20713914
Unknown
Disease name Disease term dbSNP ID References
Arsenic encephalopathy Arsenic Encephalopathy 16835338
Dermatologic disorders Dermatologic disorders 16835338

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412