Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
8870 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Immediate early response 3 |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
IER3 |
SynonymsGene synonyms aliases
|
DIF-2, DIF2, GLY96, IEX-1, IEX-1L, IEX1, PRG1 |
ChromosomeChromosome number
|
6 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
6p21.33 |
SummarySummary of gene provided in NCBI Entrez Gene.
|
This gene functions in the protection of cells from Fas- or tumor necrosis factor type alpha-induced apoptosis. Partially degraded and unspliced transcripts are found after virus infection in vitro, but these transcripts are not found in vivo and do not g |
miRNAmiRNA information provided by mirtarbase database.
|
|
Transcription factors
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
P46695 |
Protein name |
Radiation-inducible immediate-early gene IEX-1 (Differentiation-dependent gene 2 protein) (Protein DIF-2) (Immediate early protein GLY96) (Immediate early response 3 protein) (PACAP-responsive gene 1 protein) (Protein PRG1) |
Protein function |
May play a role in the ERK signaling pathway by inhibiting the dephosphorylation of ERK by phosphatase PP2A-PPP2R5C holoenzyme. Also acts as an ERK downstream effector mediating survival. As a member of the NUPR1/RELB/IER3 survival pathway, may |
Family and domains |
|
Sequence |
MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRK RSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASL APTPVSAVLEPFNLTSEPSDYALDLSTFLQQHPAAF
|
|
Sequence length |
156 |
Interactions |
View interactions |
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
|
|
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Dermatitis |
Dermatitis, Irritant |
rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 |
27258892 |
Hypertension |
Hypertensive disease |
rs13306026, rs13333226 |
20713914 |
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Arsenic encephalopathy |
Arsenic Encephalopathy |
|
16835338 |
Dermatologic disorders |
Dermatologic disorders |
|
16835338 |
|