NR1I2 (nuclear receptor subfamily 1 group I member 2)

Gene

• Entrez ID: 8856
• Gene name: Nuclear receptor subfamily 1 group I member 2
• Gene symbol: NR1I2
• Synonyms: BXR, ONR1, PAR, PAR1, PAR2, PARq, PRR, PXR, SAR, SXR
• Chromosome: 3
• Chromosome location: 3q13.33
• Summary: This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002079	hsa-let-7a-5p	Luciferase reporter assay	17890240
MIRT002079	hsa-let-7a-5p	Luciferase reporter assay	17890240
MIRT003998	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR	18268015
MIRT051226	hsa-miR-16-5p	CLASH	23622248
MIRT040092	hsa-miR-615-3p	CLASH	23622248
MIRT731924	hsa-miR-30c-1-3p	Luciferase reporter assay	27085140
MIRT731924	hsa-miR-30c-1-3p	Luciferase reporter assay	27085140
MIRT733495	hsa-miR-18a-5p	Luciferase reporter assay, Western blot	28408657
MIRT733495	hsa-miR-18a-5p	Luciferase reporter assay, qRT-PCR, Western blotting	31998607
MIRT733495	hsa-miR-18a-5p	Luciferase reporter assay, qRT-PCR, Western blotting	31998607
MIRT003998	hsa-miR-148a-3p	Western blotting, qRT-PCR, in vitro cullelar assays, Flow cytometry	35276090
MIRT1192158	hsa-miR-2467-3p	CLIP-seq
MIRT1192159	hsa-miR-3664-3p	CLIP-seq
MIRT1192160	hsa-miR-3678-3p	CLIP-seq
MIRT1192161	hsa-miR-3908	CLIP-seq
MIRT1192162	hsa-miR-4432	CLIP-seq
MIRT1192163	hsa-miR-4743	CLIP-seq
MIRT1192164	hsa-miR-510	CLIP-seq
MIRT1192165	hsa-miR-548u	CLIP-seq
MIRT1192166	hsa-miR-663b	CLIP-seq
MIRT1192167	hsa-miR-873	CLIP-seq
MIRT1192168	hsa-miR-3545-3p	CLIP-seq
MIRT1192169	hsa-miR-4447	CLIP-seq
MIRT1192170	hsa-miR-4472	CLIP-seq
MIRT1192171	hsa-miR-4481	CLIP-seq
MIRT1192172	hsa-miR-4494	CLIP-seq
MIRT1192173	hsa-miR-4499	CLIP-seq
MIRT1192174	hsa-miR-4539	CLIP-seq
MIRT1192175	hsa-miR-4651	CLIP-seq
MIRT1192176	hsa-miR-4700-3p	CLIP-seq
MIRT1192177	hsa-miR-4724-5p	CLIP-seq
MIRT1192178	hsa-miR-4745-5p	CLIP-seq
MIRT1192179	hsa-miR-4747-5p	CLIP-seq
MIRT1192180	hsa-miR-4759	CLIP-seq
MIRT1192181	hsa-miR-4795-5p	CLIP-seq
MIRT1192182	hsa-miR-608	CLIP-seq
MIRT1192183	hsa-miR-637	CLIP-seq
MIRT2455369	hsa-miR-1179	CLIP-seq
MIRT2455370	hsa-miR-1912	CLIP-seq
MIRT2455371	hsa-miR-3130-5p	CLIP-seq
MIRT2455372	hsa-miR-338-3p	CLIP-seq
MIRT2455373	hsa-miR-4310	CLIP-seq
MIRT2455374	hsa-miR-4323	CLIP-seq
MIRT2455375	hsa-miR-4482	CLIP-seq
MIRT1192167	hsa-miR-873	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
DR1	Activation	18305375
HNF4A	Activation	12601364;18305375
NCOR2	Unknown	16219912
NR1H4	Activation	21476904
NR3C1	Unknown	12815172
PROX1	Repression	22023334

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA	21873635
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	11114890
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	11114890
GO:0004879	Function	Nuclear receptor activity	IBA	21873635
GO:0004879	Function	Nuclear receptor activity	IDA	12578355
GO:0005515	Function	Protein binding	IPI	12578355, 20413580, 22939624, 23602807
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of transcription, DNA-templated	IDA	9727070
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	TAS
GO:0006805	Process	Xenobiotic metabolic process	IDA	12578355
GO:0007165	Process	Signal transduction	TAS	9784494
GO:0008144	Function	Drug binding	IDA	12578355
GO:0008202	Process	Steroid metabolic process	TAS	9784494
GO:0008270	Function	Zinc ion binding	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016922	Function	Nuclear receptor binding	IDA	9727070
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030522	Process	Intracellular receptor signaling pathway	IEA
GO:0042738	Process	Exogenous drug catabolic process	IDA	12578355
GO:0042908	Process	Xenobiotic transport	IDA	12578355
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	11891224
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	12578355
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11114890
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 603065
• HGNC: 7968
• e!Ensembl: ENSG00000144852

Protein

• UniProt ID: O75469
• Protein name: Nuclear receptor subfamily 1 group I member 2 (Orphan nuclear receptor PAR1) (Orphan nuclear receptor PXR) (Pregnane X receptor) (Steroid and xenobiotic receptor) (SXR)
• Protein function: Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics,
• PDB: 1ILG, 1ILH, 1M13, 1NRL, 1SKX, 2O9I, 2QNV, 3CTB, 3HVL, 3R8D, 4J5W, 4J5X, 4NY9, 4S0S, 4S0T, 4X1F, 4X1G, 4XAO, 4XHD, 5A86, 5X0R, 6BNS, 6DUP, 6HJ2, 6HTY, 6NX1, 6P2B, 6S41, 6TFI, 6XP9, 7AX8, 7AX9, 7AXA, 7AXB, 7AXC, 7AXD, 7AXE, 7AXF, 7AXG, 7AXH, 7AXI, 7AXJ, 7AXK, 7AXL, 7N2A, 7RIO, 7RIU, 7RIV, 7YFK, 8CCT, 8CF9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00105	zf-C4	39 → 109	Zinc finger, C4 type (two domains)	Domain
  PF00104	Hormone_recep	238 → 415	Ligand-binding domain of nuclear hormone receptor	Domain

• Sequence:

  MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEG
  CKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEE
  RRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSS
  GCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLL
  PHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWE
  CGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHR
  VVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPF
  ATPLMQELFGITGS

• Sequence length: 434

Pathways

Reactome:

Nuclear Receptor transcription pathway
SUMOylation of intracellular receptors

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Adenocarcinoma	Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular	rs121913530, rs886039394, rs121913474	21977915
Carcinoma	Carcinoma, Cribriform, Carcinoma, Granular Cell	rs121912654, rs555607708, rs786202962, rs1564055259	21977915
Diabetes mellitus	Diabetes Mellitus	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs1553638903, rs1553638909, rs948820149, rs371977235, rs1553784995, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	20869355
Esophagus neoplasm	Esophageal Neoplasms, Malignant neoplasm of esophagus	rs28934578, rs121918714, rs1567556006, rs1575166666	21977915
Metabolic syndrome	Metabolic Syndrome X	rs367643250, rs587777380, rs777736953	20869355
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	20869355

Unknown
Disease name	Disease term	dbSNP ID	References
Barrett epithelium	Barrett Epithelium		21977915
Barrett esophagus	Barrett Esophagus	rs41341748	21977915
Fatty liver	Fatty Liver, Steatohepatitis		25182422
Fibroatheroma	Fibroatheroma		29425287
Osteosarcoma	Osteosarcoma		17279585
Subfertility	Subfertility, Female		23710174