CCN4 (cellular communication network factor 4)

Gene

• Entrez ID: 8840
• Gene name: Cellular communication network factor 4
• Gene symbol: CCN4
• Synonyms: WISP1, WISP1-OT1, WISP1-UT1, WISP1c, WISP1i, WISP1tc
• Chromosome: 8
• Chromosome location: 8q24.22
• Summary: This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate di

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001817	Process	Regulation of cytokine production	IDA	25281430
GO:0005178	Function	Integrin binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	11598131, 20684029, 32296183
GO:0005520	Function	Insulin-like growth factor binding	IEA
GO:0005615	Component	Extracellular space	IDA	25281430
GO:0005615	Component	Extracellular space	NAS	9843955
GO:0005829	Component	Cytosol	IDA
GO:0007155	Process	Cell adhesion	IBA	21873635
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0007267	Process	Cell-cell signaling	TAS	9843955
GO:0008201	Function	Heparin binding	IBA	21873635
GO:0014911	Process	Positive regulation of smooth muscle cell migration	ISS
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030177	Process	Positive regulation of Wnt signaling pathway	IEA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0031012	Component	Extracellular matrix	IBA	21873635
GO:0032331	Process	Negative regulation of chondrocyte differentiation	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IMP	20684029
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	ISS
GO:0050729	Process	Positive regulation of inflammatory response	IDA	25281430
GO:0060348	Process	Bone development	IEA
GO:0060548	Process	Negative regulation of cell death	IBA	21873635
GO:0090303	Process	Positive regulation of wound healing	IEA

Other IDs

• MIM: 603398
• HGNC: 12769
• e!Ensembl: ENSG00000104415

Protein

• UniProt ID: O95388
• Protein name: CCN family member 4 (WNT1-inducible-signaling pathway protein 1) (WISP-1) (Wnt-1-induced secreted protein)
• Protein function: Downstream regulator in the Wnt/Frizzled-signaling pathway. Associated with cell survival. Attenuates p53-mediated apoptosis in response to DNA damage through activation of AKT kinase. Up-regulates the anti-apoptotic Bcl-X(L) protein. Adheres to
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00219	IGFBP	49 → 101	Insulin-like growth factor binding protein	Domain
  PF00093	VWC	123 → 185	von Willebrand factor type C domain	Family
  PF19035	TSP1_CCN	216 → 259	CCN3 Nov like TSP1 domain	Domain
  PF00007	Cys_knot	270 → 363	Cystine-knot domain	Domain

• Sequence:

  MRWFLPWTLAAVTAAAASTVLATALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPP
  RCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVG
  VGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCC
  EQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISN
  VNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQPKY
  CGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFCNLSCRNPNDIFADLESYP
  DFSEIAN

• Sequence length: 367

Pathways

KEGG:

Wnt signaling pathway

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Autoimmune diseases	Autoimmune Diseases, AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1, AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 2	rs41285370, rs869025224	30595370
Hypothyroidism	Hypothyroidism	rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912, rs121917847, rs104893655, rs104893657, rs104893658, rs104893659, rs104893660, rs104893656, rs121917719, rs786204790, rs189261858, rs879255608, rs868197660, rs879255609, rs1586744173, rs1586182837, rs771222349, rs1587618417, rs1601844140, rs760832986, rs780982673, rs1603336347, rs1691155605	30595370
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601	27903959