SOCS2 (suppressor of cytokine signaling 2)

Gene

• Entrez ID: 8835
• Gene name: Suppressor of cytokine signaling 2
• Gene symbol: SOCS2
• Synonyms: CIS2, Cish2, SOCS-2, SSI-2, SSI2, STATI2
• Chromosome: 12
• Chromosome location: 12q22
• Summary: This gene encodes a member of the suppressor of cytokine signaling (SOCS) family. SOCS family members are cytokine-inducible negative regulators of cytokine receptor signaling via the Janus kinase/signal transducer and activation of transcription pathway

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005896	hsa-miR-194-5p	Luciferase reporter assay, qRT-PCR, Western blot	20979124
MIRT025940	hsa-miR-7-5p	Microarray	17612493
MIRT051211	hsa-miR-16-5p	CLASH	23622248
MIRT731524	hsa-miR-424-5p	Luciferase reporter assay	27038552
MIRT731524	hsa-miR-424-5p	Luciferase reporter assay	27038552
MIRT731524	hsa-miR-424-5p	Luciferase reporter assay	27038552
MIRT731524	hsa-miR-424-5p	Luciferase reporter assay	27038552
MIRT733921	hsa-miR-486-5p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	32472154
MIRT005896	hsa-miR-194-5p	Microarray, qRT-PCR	35816043
MIRT756162	hsa-miR-492	Luciferase reporter assay, Western blotting, qRT-PCR	34652255
MIRT756198	hsa-miR-761	Luciferase reporter assay, Western blotting, qRT-PCR	36119773
MIRT1378516	hsa-miR-3655	CLIP-seq
MIRT1378517	hsa-miR-511	CLIP-seq
MIRT1378518	hsa-miR-578	CLIP-seq
MIRT2112958	hsa-miR-1264	CLIP-seq
MIRT2112959	hsa-miR-2117	CLIP-seq
MIRT2112960	hsa-miR-376c	CLIP-seq
MIRT2112961	hsa-miR-4311	CLIP-seq
MIRT2112962	hsa-miR-4753-3p	CLIP-seq
MIRT2112963	hsa-miR-507	CLIP-seq
MIRT2112964	hsa-miR-557	CLIP-seq
MIRT2112965	hsa-miR-587	CLIP-seq
MIRT2112966	hsa-miR-659	CLIP-seq
MIRT2112967	hsa-miR-767-5p	CLIP-seq
MIRT2112958	hsa-miR-1264	CLIP-seq
MIRT2335850	hsa-miR-3145-3p	CLIP-seq
MIRT2112963	hsa-miR-507	CLIP-seq
MIRT2112964	hsa-miR-557	CLIP-seq
MIRT2112965	hsa-miR-587	CLIP-seq
MIRT2112966	hsa-miR-659	CLIP-seq
MIRT2112967	hsa-miR-767-5p	CLIP-seq
MIRT2630120	hsa-miR-1323	CLIP-seq
MIRT2630121	hsa-miR-495	CLIP-seq
MIRT2630122	hsa-miR-499-3p	CLIP-seq
MIRT2630123	hsa-miR-499a-3p	CLIP-seq
MIRT2630124	hsa-miR-548o	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
IRF1	Activation	22291912
IRF3	Activation	22291912

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	NAS	9727029
GO:0005131	Function	Growth hormone receptor binding	NAS	12135564
GO:0005159	Function	Insulin-like growth factor receptor binding	IPI	9727029
GO:0005515	Function	Protein binding	IPI	11781573, 16643902, 19159283, 21145461, 23401859, 24728074, 28514442, 29997244, 30833792, 31578312, 32296183, 32814053
GO:0005737	Component	Cytoplasm	NAS	9727029
GO:0005829	Component	Cytosol	TAS
GO:0005942	Component	Phosphatidylinositol 3-kinase complex	IBA	21873635
GO:0007259	Process	Receptor signaling pathway via JAK-STAT	TAS	9266833
GO:0007595	Process	Lactation	IEA
GO:0008269	Function	JAK pathway signal transduction adaptor activity	IEA
GO:0009966	Process	Regulation of signal transduction	NAS	9727029
GO:0016567	Process	Protein ubiquitination	IEA
GO:0032355	Process	Response to estradiol	IDA	12552091
GO:0032870	Process	Cellular response to hormone stimulus	IDA	12552091
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0038111	Process	Interleukin-7-mediated signaling pathway	TAS
GO:0040015	Process	Negative regulation of multicellular organism growth	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	9266833
GO:0043551	Process	Regulation of phosphatidylinositol 3-kinase activity	IEA
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IEA
GO:0046854	Process	Phosphatidylinositol phosphorylation	IBA	21873635
GO:0046935	Function	1-phosphatidylinositol-3-kinase regulator activity	IBA	21873635
GO:0060396	Process	Growth hormone receptor signaling pathway	IDA	12552091
GO:0060749	Process	Mammary gland alveolus development	IEA

Other IDs

• MIM: 605117
• HGNC: 19382
• e!Ensembl: ENSG00000120833

Protein

• UniProt ID: O14508
• Protein name: Suppressor of cytokine signaling 2 (SOCS-2) (Cytokine-inducible SH2 protein 2) (CIS-2) (STAT-induced STAT inhibitor 2) (SSI-2)
• Protein function: Substrate-recognition component of a cullin-5-RING E3 ubiquitin-protein ligase complex (ECS complex, also named CRL5 complex), which mediates the ubiquitination and subsequent proteasomal degradation of target proteins, such as EPOR and GHR (Pub
• PDB: 2C9W, 4JGH, 5BO4, 6I4X, 6I5J, 6I5N, 7M6T, 7ZLM, 7ZLN, 7ZLO, 7ZLP, 7ZLR, 7ZLS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00017	SH2	48 → 129	SH2 domain	Domain
  PF07525	SOCS_box	161 → 194	SOCS box	Domain

• Sequence:

  MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKE
  KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
  SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWG
  LPLPTRLKDYLEEYKFQV

• Sequence length: 198

Pathways

KEGG:

JAK-STAT signaling pathway
Insulin signaling pathway
Prolactin signaling pathway
Type II diabetes mellitus
Growth hormone synthesis, secretion and action

Reactome:

Interleukin-7 signaling
Neddylation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Dermatitis	Dermatitis, Allergic Contact	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	16033404
Narcolepsy	Narcolepsy	rs104894574, rs387906655	17521418
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	25283341

Unknown
Disease name	Disease term	dbSNP ID	References
Liver carcinoma	Liver carcinoma		28284560
Narcolepsy-cataplexy syndrome	Narcolepsy-Cataplexy Syndrome		17521418