FGF18 (fibroblast growth factor 18)

Gene

• Entrez ID: 8817
• Gene name: Fibroblast growth factor 18
• Gene symbol: FGF18
• Synonyms: FGF-18, ZFGF5
• Chromosome: 5
• Chromosome location: 5q35.1
• Summary: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cel

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1441510334	C>T	Likely-pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT995607	hsa-miR-122	CLIP-seq
MIRT995608	hsa-miR-129-5p	CLIP-seq
MIRT995609	hsa-miR-3192	CLIP-seq
MIRT995610	hsa-miR-3659	CLIP-seq
MIRT995611	hsa-miR-369-3p	CLIP-seq
MIRT995612	hsa-miR-374a	CLIP-seq
MIRT995613	hsa-miR-374b	CLIP-seq
MIRT995614	hsa-miR-4314	CLIP-seq
MIRT995615	hsa-miR-4328	CLIP-seq
MIRT995616	hsa-miR-4646-5p	CLIP-seq
MIRT995617	hsa-miR-4658	CLIP-seq
MIRT995618	hsa-miR-4753-3p	CLIP-seq
MIRT995619	hsa-miR-574-5p	CLIP-seq
MIRT995608	hsa-miR-129-5p	CLIP-seq
MIRT1921433	hsa-miR-3942-3p	CLIP-seq
MIRT995608	hsa-miR-129-5p	CLIP-seq
MIRT1921433	hsa-miR-3942-3p	CLIP-seq
MIRT995608	hsa-miR-129-5p	CLIP-seq
MIRT1921433	hsa-miR-3942-3p	CLIP-seq
MIRT995615	hsa-miR-4328	CLIP-seq
MIRT995619	hsa-miR-574-5p	CLIP-seq
MIRT2449659	hsa-miR-3153	CLIP-seq
MIRT2449660	hsa-miR-4278	CLIP-seq
MIRT2449661	hsa-miR-4668-5p	CLIP-seq
MIRT2449662	hsa-miR-4716-3p	CLIP-seq
MIRT2449663	hsa-miR-4723-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0001525	Process	Angiogenesis	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IBA	21873635
GO:0001936	Process	Regulation of endothelial cell proliferation	IDA	16756958
GO:0001957	Process	Intramembranous ossification	IEA
GO:0001958	Process	Endochondral ossification	IEA
GO:0002063	Process	Chondrocyte development	IEA
GO:0005104	Function	Fibroblast growth factor receptor binding	IBA	21873635
GO:0005105	Function	Type 1 fibroblast growth factor receptor binding	IBA	21873635
GO:0005105	Function	Type 1 fibroblast growth factor receptor binding	IDA	16384934
GO:0005111	Function	Type 2 fibroblast growth factor receptor binding	IBA	21873635
GO:0005111	Function	Type 2 fibroblast growth factor receptor binding	IDA	16384934
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0007165	Process	Signal transduction	TAS	9742123
GO:0007267	Process	Cell-cell signaling	TAS	9742123
GO:0008083	Function	Growth factor activity	IBA	21873635
GO:0008284	Process	Positive regulation of cell population proliferation	IBA	21873635
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA	21873635
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	TAS
GO:0009653	Process	Anatomical structure morphogenesis	TAS	9742123
GO:0009887	Process	Animal organ morphogenesis	IBA	21873635
GO:0010628	Process	Positive regulation of gene expression	IBA	21873635
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030324	Process	Lung development	IEA
GO:0030334	Process	Regulation of cell migration	IBA	21873635
GO:0030949	Process	Positive regulation of vascular endothelial growth factor receptor signaling pathway	IEA
GO:0032332	Process	Positive regulation of chondrocyte differentiation	IEA
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	16756958
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IGI	25449503
GO:0045766	Process	Positive regulation of angiogenesis	IGI	25449503
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:1903670	Process	Regulation of sprouting angiogenesis	IDA	16756958
GO:2000546	Process	Positive regulation of endothelial cell chemotaxis to fibroblast growth factor	IDA	16756958

Other IDs

• MIM: 603726
• HGNC: 3674
• e!Ensembl: ENSG00000156427

Protein

• UniProt ID: O76093
• Protein name: Fibroblast growth factor 18 (FGF-18) (zFGF5)
• Protein function: Plays an important role in the regulation of cell proliferation, cell differentiation and cell migration. Required for normal ossification and bone development. Stimulates hepatic and intestinal proliferation.
• PDB: 4CJM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00167	FGF	53 → 175	Fibroblast growth factor	Domain

• Sequence:

  MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSR
  TSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKP
  DGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPK
  GQPELQKPFKYTTVTKRSRRIRPTHPA

• Sequence length: 207

Pathways

KEGG:

MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Chemical carcinogenesis - receptor activation
Melanoma
Breast cancer
Gastric cancer

Reactome:

PI3K Cascade
PIP3 activates AKT signaling
Signaling by activated point mutants of FGFR3
FGFR4 ligand binding and activation
FGFR3b ligand binding and activation
FGFR3c ligand binding and activation
FGFR2c ligand binding and activation
FGFR3 mutant receptor activation
Activated point mutants of FGFR2
Constitutive Signaling by Aberrant PI3K in Cancer
Phospholipase C-mediated cascade; FGFR2
Phospholipase C-mediated cascade; FGFR3
Phospholipase C-mediated cascade; FGFR4
PI-3K cascade:FGFR2
SHC-mediated cascade:FGFR2
FRS-mediated FGFR2 signaling
SHC-mediated cascade:FGFR3
FRS-mediated FGFR3 signaling
PI-3K cascade:FGFR3
FRS-mediated FGFR4 signaling
SHC-mediated cascade:FGFR4
PI-3K cascade:FGFR4
Negative regulation of FGFR2 signaling
Negative regulation of FGFR3 signaling
Negative regulation of FGFR4 signaling
Signaling by FGFR2 in disease
FGFRL1 modulation of FGFR1 signaling
RAF/MAP kinase cascade
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Signaling by FGFR3 point mutants in cancer

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Arthritis	Degenerative polyarthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	30664745

Unknown
Disease name	Disease term	dbSNP ID	References
Knee osteoarthritis	Osteoarthritis, Knee		30664745
Malignant mesothelioma	Malignant mesothelioma		25756049
Osteoarthritis of hip	Osteoarthritis of hip		30664745
Osteoarthrosis deformans	Osteoarthrosis Deformans		30664745
Sclerocystic ovaries	Sclerocystic Ovaries		21411543
Polycystic ovary syndrome	Polycystic Ovary Syndrome		21411543