IL18R1 (interleukin 18 receptor 1)

Gene

• Entrez ID: 8809
• Gene name: Interleukin 18 receptor 1
• Gene symbol: IL18R1
• Synonyms: CD218a, CDw218a, IL-18R-alpha, IL-18Ralpha, IL-1Rrp, IL18RA, IL18Ralpha2, IL1RRP
• Chromosome: 2
• Chromosome location: 2q12.1
• Summary: The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This receptor specifically binds interleukin 18 (IL18), and is essential for IL18 mediated signal transduction. IFN-alpha and IL12 are reported to i

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023090	hsa-miR-124-3p	Microarray	18668037
MIRT1064169	hsa-miR-3064-3p	CLIP-seq
MIRT1064170	hsa-miR-3914	CLIP-seq
MIRT1064171	hsa-miR-4264	CLIP-seq
MIRT1064172	hsa-miR-4704-3p	CLIP-seq
MIRT1064173	hsa-miR-4795-3p	CLIP-seq
MIRT1064174	hsa-miR-510	CLIP-seq
MIRT1064175	hsa-miR-512-5p	CLIP-seq
MIRT1064176	hsa-miR-935	CLIP-seq
MIRT2015266	hsa-miR-1184	CLIP-seq
MIRT2015267	hsa-miR-1291	CLIP-seq
MIRT2015268	hsa-miR-3163	CLIP-seq
MIRT2015269	hsa-miR-3173-5p	CLIP-seq
MIRT1064171	hsa-miR-4264	CLIP-seq
MIRT2015270	hsa-miR-4517	CLIP-seq
MIRT2015271	hsa-miR-4649-3p	CLIP-seq
MIRT1064172	hsa-miR-4704-3p	CLIP-seq
MIRT1064174	hsa-miR-510	CLIP-seq
MIRT1064173	hsa-miR-4795-3p	CLIP-seq
MIRT2247566	hsa-miR-659	CLIP-seq
MIRT2247567	hsa-miR-889	CLIP-seq
MIRT2437787	hsa-miR-494	CLIP-seq
MIRT2550933	hsa-miR-129-5p	CLIP-seq
MIRT2550934	hsa-miR-216a	CLIP-seq
MIRT2550935	hsa-miR-4639-3p	CLIP-seq
MIRT2247566	hsa-miR-659	CLIP-seq
MIRT2247567	hsa-miR-889	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004908	Function	Interleukin-1 receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	25261253
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	TAS	9325300
GO:0007165	Process	Signal transduction	TAS	9325300
GO:0030101	Process	Natural killer cell activation	IEA
GO:0032729	Process	Positive regulation of interferon-gamma production	IBA	21873635
GO:0032729	Process	Positive regulation of interferon-gamma production	IDA	10653850
GO:0035655	Process	Interleukin-18-mediated signaling pathway	IBA	21873635
GO:0035655	Process	Interleukin-18-mediated signaling pathway	IDA	25500532
GO:0035655	Process	Interleukin-18-mediated signaling pathway	TAS
GO:0038023	Function	Signaling receptor activity	TAS	9325300
GO:0042007	Function	Interleukin-18 binding	IBA	21873635
GO:0042007	Function	Interleukin-18 binding	IDA	14528293, 25261253, 25500532
GO:0042008	Function	Interleukin-18 receptor activity	IBA	21873635
GO:0042008	Function	Interleukin-18 receptor activity	IDA	25500532
GO:0045063	Process	T-helper 1 cell differentiation	IEA
GO:0045092	Component	Interleukin-18 receptor complex	IDA	25500532
GO:0050135	Function	NAD(P)+ nucleosidase activity	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	25500532
GO:0061809	Function	NAD+ nucleotidase, cyclic ADP-ribose generating	IEA
GO:0071345	Process	Cellular response to cytokine stimulus	TAS
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	26656097
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	IEA
GO:2000556	Process	Positive regulation of T-helper 1 cell cytokine production	IDA	10653850

Other IDs

• MIM: 604494
• HGNC: 5988
• e!Ensembl: ENSG00000115604

Protein

• UniProt ID: Q13478
• Protein name: Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (EC 3.2.2.6) (CD218 antigen-like family member A) (CDw218a) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (Interleukin-18 receptor alpha) (IL-18R-alpha) (IL-18Ralpha) (CD antigen CD218a)
• Protein function: Within the IL18 receptor complex, responsible for the binding of the pro-inflammatory cytokine IL18, but not IL1A nor IL1B (PubMed:14528293, PubMed:25261253, PubMed:25500532, PubMed:37993714, PubMed:8626725). Involved in IL18-mediated IFNG synth
• PDB: 3WO3, 3WO4, 4R6U
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01582	TIR	377 → 540	TIR domain	Family

• Sequence:

  MNCRELPLTLWVLISVSTAESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSS
  GSQEHVELNPRSSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCF
  TERQVTSKIVEVKKFFQITCENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQ
  GYYSCVHFLHHNGKLFNITKTFNITIVEDRSNIVPVLLGPKLNHVAVELGKNVRLNCSAL
  LNEEDVIYWMFGEENGSDPNIHEEKEMRIMTPEGKWHASKVLRIENIGESNLNVLYNCTV
  ASTGGTDTKSFILVRKADMADIPGHVFTRGMIIAVLILVAVVCLVTVCVIYRVDLVLFYR
  HLTRRDETLTDGKTYDAFVSYLKECRPENGEEHTFAVEILPRVLEKHFGYKLCIFERDVV
  PGGAVVDEIHSLIEKSRRLIIVLSKSYMSNEVRYELESGLHEALVERKIKIILIEFTPVT
  DFTFLPQSLKLLKSHRVLKWKADKSLSYNSRFWKNLLYLMPAKTVKPGRDEPEVLPVLSE
  S

• Sequence length: 541

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
TNF signaling pathway
Inflammatory bowel disease

Reactome:

Interleukin-37 signaling
Interleukin-18 signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Asthma	Asthma, Childhood asthma	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	23028483, 21804549, 24388013, 21907864, 29273806, 30578877, 31036433, 22561531, 27130862, 31619474, 30552067, 20860503, 29785011, 30929738, 30929738, 29273806, 31036433
Dermatitis	Dermatitis, Atopic	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	23042114, 26482879
Esophagus neoplasm	Esophageal Neoplasms	rs28934578, rs121918714, rs1567556006, rs1575166666	22960999
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs139868987, rs750447828, rs368138379, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468	26192919, 28067908
Leprosy	Leprosy	rs121917864, rs2239704	25642632
Psoriasis	Psoriasis	rs281875215, rs587777763, rs281875213, rs281875212	26974007
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	17522711

Unknown
Disease name	Disease term	dbSNP ID	References
Allergic rhinitis	Allergic rhinitis (disorder)		30013184
Allergic sensitization	Allergic sensitization		23817571
Ankylosing spondylitis	Ankylosing spondylitis		26974007
Celiac disease	Celiac Disease	rs2305764, rs35218876	18311140
Cholangitis	Cholangitis, Sclerosing		26974007
Crohn disease	Crohn Disease	rs2066847, rs2066844, rs886052047, rs5743265, rs111608429, rs104895438	26974007, 28067908
Eczema	Eczema		30595370
Nasal polyposis	Nasal Polyps		30643255
Respiratory tract diseases	Respiratory Tract Diseases		30595370
Ulcerative colitis	Ulcerative Colitis		26974007