IL18RAP (interleukin 18 receptor accessory protein)

Gene

• Entrez ID: 8807
• Gene name: Interleukin 18 receptor accessory protein
• Gene symbol: IL18RAP
• Synonyms: ACPL, CD218b, CDw218b, IL-18R-beta, IL-18RAcP, IL-18Rbeta, IL-1R-7, IL-1R7, IL-1RAcPL, IL18RB
• Chromosome: 2
• Chromosome location: 2q12.1
• Summary: The protein encoded by this gene is an accessory subunit of the heterodimeric receptor for interleukin 18 (IL18), a proinflammatory cytokine involved in inducing cell-mediated immunity. This protein enhances the IL18-binding activity of the IL18 receptor

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT626786	hsa-miR-8485	HITS-CLIP	23824327
MIRT626785	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT626786	hsa-miR-8485	HITS-CLIP	23824327
MIRT626785	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT1064177	hsa-miR-1269	CLIP-seq
MIRT1064178	hsa-miR-1269b	CLIP-seq
MIRT1064179	hsa-miR-1288	CLIP-seq
MIRT1064180	hsa-miR-1915	CLIP-seq
MIRT1064181	hsa-miR-3199	CLIP-seq
MIRT1064182	hsa-miR-3654	CLIP-seq
MIRT1064183	hsa-miR-378	CLIP-seq
MIRT1064184	hsa-miR-378b	CLIP-seq
MIRT1064185	hsa-miR-378c	CLIP-seq
MIRT1064186	hsa-miR-378d	CLIP-seq
MIRT1064187	hsa-miR-378e	CLIP-seq
MIRT1064188	hsa-miR-378f	CLIP-seq
MIRT1064189	hsa-miR-378h	CLIP-seq
MIRT1064190	hsa-miR-378i	CLIP-seq
MIRT1064191	hsa-miR-422a	CLIP-seq
MIRT1064192	hsa-miR-4515	CLIP-seq
MIRT1064193	hsa-miR-4726-3p	CLIP-seq
MIRT1064194	hsa-miR-4733-5p	CLIP-seq
MIRT1064195	hsa-miR-4740-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	TAS	9792649
GO:0008283	Process	Cell population proliferation	IEA
GO:0035655	Process	Interleukin-18-mediated signaling pathway	IBA	21873635
GO:0035655	Process	Interleukin-18-mediated signaling pathway	IDA	25500532
GO:0035655	Process	Interleukin-18-mediated signaling pathway	TAS
GO:0042008	Function	Interleukin-18 receptor activity	IBA	21873635
GO:0042008	Function	Interleukin-18 receptor activity	IDA	25500532
GO:0042119	Process	Neutrophil activation	IEA
GO:0045092	Component	Interleukin-18 receptor complex	IDA	25500532
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IEA
GO:0050135	Function	NAD(P)+ nucleosidase activity	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IBA	21873635
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	25500532
GO:0061809	Function	NAD+ nucleotidase, cyclic ADP-ribose generating	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA

Other IDs

• MIM: 604509
• HGNC: 5989
• e!Ensembl: ENSG00000115607

Protein

• UniProt ID: O95256
• Protein name: Interleukin-18 receptor accessory protein (IL-18 receptor accessory protein) (IL-18RAcP) (EC 3.2.2.6) (Accessory protein-like) (AcPL) (CD218 antigen-like family member B) (CDw218b) (IL-1R accessory protein-like) (IL-1RAcPL) (Interleukin-1 receptor 7) (IL-
• Protein function: Within the IL18 receptor complex, does not mediate IL18-binding, but involved in IL18-dependent signal transduction, leading to NF-kappa-B and JNK activation (PubMed:14528293, PubMed:25500532, PubMed:9792649). May play a role in IL18-mediated IF
• PDB: 3WO4, 6KN9, 7FCH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF18452	Ig_6	100 → 155	Immunoglobulin domain	Domain
  PF13895	Ig_2	154 → 242	Immunoglobulin domain	Domain
  PF01582	TIR	410 → 597	TIR domain	Family

• Sequence:

  MLCLGWIFLWLVAGERIKGFNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRN
  RLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNN
  SGSYICRPKMIKSPYDVACCVKMILEVKPQTNASCEYSASHKQDLLLGSTGSISCPSLSC
  QSDAQSPAVTWYKNGKLLSVERSNRIVVDEVYDYHQGTYVCDYTQSDTVSSWTVRAVVQV
  RTIVGDTKLKPDILDPVEDTLEVELGKPLTISCKARFGFERVFNPVIKWYIKDSDLEWEV
  SVPEAKSIKSTLKDEIIERNIILEKVTQRDLRRKFVCFVQNSIGNTTQSVQLKEKRGVVL
  LYILLGTIGTLVAVLAASALLYRHWIEIVLLYRTYQSKDQTLGDKKDFDAFVSYAKWSSF
  PSEATSSLSEEHLALSLFPDVLENKYGYSLCLLERDVAPGGVYAEDIVSIIKRSRRGIFI
  LSPNYVNGPSIFELQAAVNLALDDQTLKLILIKFCYFQEPESLPHLVKKALRVLPTVTWR
  GLKSVPPNSRFWAKMRYHMPVKNSQGFTWNQLRITSRIFQWKGLSRTETTGRSSQPKEW

• Sequence length: 599

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Inflammatory bowel disease

Reactome:

Interleukin-18 signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Asthma	Asthma	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	20860503
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs139868987, rs750447828, rs368138379, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468	26192919, 21983784

Unknown
Disease name	Disease term	dbSNP ID	References
Crohn disease	Crohn Disease	rs2066847, rs2066844, rs886052047, rs5743265, rs111608429, rs104895438	21102463, 26192919
Lupus erythematosus	Lupus Erythematosus, Systemic		28714469
Ulcerative colitis	Ulcerative Colitis		20228799