TNFRSF14 (TNF receptor superfamily member 14)

Gene

• Entrez ID: 8764
• Gene name: TNF receptor superfamily member 14
• Gene symbol: TNFRSF14
• Synonyms: ATAR, CD270, HVEA, HVEM, LIGHTR, TR2
• Chromosome: 1
• Chromosome location: 1p36.32
• Summary: This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral e

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1442976	hsa-miR-3138	CLIP-seq
MIRT1442977	hsa-miR-4520a-3p	CLIP-seq
MIRT1442978	hsa-miR-718	CLIP-seq
MIRT1442979	hsa-miR-876-3p	CLIP-seq
MIRT2132563	hsa-miR-188-3p	CLIP-seq
MIRT2132564	hsa-miR-2861	CLIP-seq
MIRT2132565	hsa-miR-370	CLIP-seq
MIRT2132566	hsa-miR-4649-3p	CLIP-seq
MIRT2132567	hsa-miR-4663	CLIP-seq
MIRT2132568	hsa-miR-4717-5p	CLIP-seq
MIRT2132569	hsa-miR-532-3p	CLIP-seq
MIRT2353512	hsa-miR-214	CLIP-seq
MIRT2132564	hsa-miR-2861	CLIP-seq
MIRT2353513	hsa-miR-3619-5p	CLIP-seq
MIRT2132565	hsa-miR-370	CLIP-seq
MIRT2132566	hsa-miR-4649-3p	CLIP-seq
MIRT2132567	hsa-miR-4663	CLIP-seq
MIRT2132568	hsa-miR-4717-5p	CLIP-seq
MIRT2353514	hsa-miR-761	CLIP-seq
MIRT2693698	hsa-miR-2355-5p	CLIP-seq
MIRT2693699	hsa-miR-4267	CLIP-seq
MIRT2693700	hsa-miR-564	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	IBA	21873635
GO:0005031	Function	Tumor necrosis factor-activated receptor activity	TAS	9153189
GO:0005515	Function	Protein binding	IPI	9153189, 9162022, 9462508, 10318773, 18193050, 19332782, 26977880, 27152329, 32814053
GO:0005886	Component	Plasma membrane	IDA	18193050
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	TAS	9162022
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9153189
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0016021	Component	Integral component of membrane	IEA
GO:0019955	Function	Cytokine binding	IPI	27152329
GO:0031295	Process	T cell costimulation	IDA	10754304
GO:0031295	Process	T cell costimulation	TAS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11279055
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0045087	Process	Innate immune response	IEA
GO:0046642	Process	Negative regulation of alpha-beta T cell proliferation	IBA	21873635
GO:0046718	Process	Viral entry into host cell	IEA
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IBA	21873635
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA	21873635
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA	21873635
GO:1905675	Process	Negative regulation of adaptive immune memory response	IDA	18193050
GO:2000406	Process	Positive regulation of T cell migration	IBA	21873635

Other IDs

• MIM: 602746
• HGNC: 11912
• e!Ensembl: ENSG00000157873

Protein

• UniProt ID: Q92956
• Protein name: Tumor necrosis factor receptor superfamily member 14 (Herpes virus entry mediator A) (Herpesvirus entry mediator A) (HveA) (Tumor necrosis factor receptor-like 2) (TR2) (CD antigen CD270)
• Protein function: Receptor for four distinct ligands: The TNF superfamily members TNFSF14/LIGHT and homotrimeric LTA/lymphotoxin-alpha and the immunoglobulin superfamily members BTLA and CD160, altogether defining a complex stimulatory and inhibitory signaling ne
• PDB: 1JMA, 2AW2, 4FHQ, 4RSU, 5T2Q, 5T2R, 6NG3, 7MSG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00020	TNFR_c6	78 → 119	TNFR/NGFR cysteine-rich region	Domain

• Sequence:

  MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPG
  YRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCG
  CSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQ
  HQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVS
  VQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH

• Sequence length: 283

Pathways

KEGG:

Virion - Herpesvirus
Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Herpes simplex virus 1 infection

Reactome:

Costimulation by the CD28 family
TNFs bind their physiological receptors

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Hypothyroidism	Hypothyroidism	rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912, rs121917847, rs104893655, rs104893657, rs104893658, rs104893659, rs104893660, rs104893656, rs121917719, rs786204790, rs189261858, rs879255608, rs868197660, rs879255609, rs1586744173, rs1586182837, rs771222349, rs1587618417, rs1601844140, rs760832986, rs780982673, rs1603336347, rs1691155605	30595370
Lymphoma	Lymphoma, Follicular	rs11540652, rs1592119138, rs1592123162, rs1599367044
Psoriasis	Psoriasis	rs281875215, rs587777763, rs281875213, rs281875212	26974007
Rheumatoid arthritis	Rheumatoid Arthritis	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212	20453842

Unknown
Disease name	Disease term	dbSNP ID	References
Ankylosing spondylitis	Ankylosing spondylitis		26974007
Celiac disease	Celiac Disease	rs2305764, rs35218876	20190752
Cholangitis	Cholangitis, Sclerosing		26974007
Crohn disease	Crohn Disease	rs2066847, rs2066844, rs886052047, rs5743265, rs111608429, rs104895438	26974007
Ulcerative colitis	Ulcerative Colitis		26974007