GediPNet logo

TNFSF14 (TNF superfamily member 14)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8740
Gene nameGene Name - the full gene name approved by the HGNC.
TNF superfamily member 14
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
TNFSF14
SynonymsGene synonyms aliases
CD258, HVEML, LIGHT, LTg
ChromosomeChromosome number
19
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry media
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT685905 hsa-miR-4438 HITS-CLIP 23313552
MIRT685904 hsa-miR-6504-3p HITS-CLIP 23313552
MIRT685903 hsa-miR-5095 HITS-CLIP 23313552
MIRT685902 hsa-miR-7151-3p HITS-CLIP 23313552
MIRT650331 hsa-miR-4705 HITS-CLIP 23824327
Transcription factors
Transcription factor Regulation Reference
ETS1 Activation 12215452
NFKB1 Unknown 21243522
RELA Unknown 21243522
SP1 Activation 12215452
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IPI 12393901
GO:0005125 Function Cytokine activity IEA
GO:0005164 Function Tumor necrosis factor receptor binding IEA
GO:0005515 Function Protein binding IPI 9462508, 10318773, 26977880, 27152329, 32296183
GO:0005615 Component Extracellular space IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID O43557
Protein name Tumor necrosis factor ligand superfamily member 14 (Herpes virus entry mediator ligand) (HVEM-L) (Herpesvirus entry mediator ligand) (CD antigen CD258) [Cleaved into: Tumor necrosis factor ligand superfamily member 14, membrane form; Tumor necrosis factor
Protein function Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Acts as a ligand for TNFRSF14/HVEM (PubMed:10754304, PubMed:9462508). Upon binding to TNFRSF14/HVEM, delivers costimulatory signals to T cells, le
PDB 4EN0 , 4J6G , 4KG8 , 4KGG , 4KGQ , 4RSU , 7MSG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00229 TNF
112 240
TNF(Tumour Necrosis Factor) family
Domain
Sequence
MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQ
LHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGL
AFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELL
VSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

Sequence length 240
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
NF-kappa B signaling pathway
Herpes simplex virus 1 infection
  TNFR2 non-canonical NF-kB pathway
TNFs bind their physiological receptors
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Multiple sclerosis Multiple Sclerosis, Multiple Sclerosis, Acute Fulminating rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039, rs483353038, rs61731956, rs568165874, rs767480544 24076602, 21833088, 24076602
Rheumatoid arthritis Rheumatoid Arthritis rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212 20008919

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412