MARCO (macrophage receptor with collagenous structure)

Gene

• Entrez ID: 8685
• Gene name: Macrophage receptor with collagenous structure
• Gene symbol: MARCO
• Synonyms: SCARA2, SR-A6
• Chromosome: 2
• Chromosome location: 2q14.2
• Summary: The protein encoded by this gene is a member of the class A scavenger receptor family and is part of the innate antimicrobial immune system. The protein may bind both Gram-negative and Gram-positive bacteria via an extracellular, C-terminal, scavenger rec

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	ISS
GO:0001664	Function	G protein-coupled receptor binding	IBA	21873635
GO:0001664	Function	G protein-coupled receptor binding	IPI	20141570
GO:0001664	Function	G protein-coupled receptor binding	ISS
GO:0001934	Process	Positive regulation of protein phosphorylation	ISS
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	10331948
GO:0005044	Function	Scavenger receptor activity	IEA
GO:0005581	Component	Collagen trimer	IEA
GO:0005622	Component	Intracellular anatomical structure	IBA	21873635
GO:0005737	Component	Cytoplasm	ISS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	9468508
GO:0006897	Process	Endocytosis	IBA	21873635
GO:0006898	Process	Receptor-mediated endocytosis	ISS
GO:0006898	Process	Receptor-mediated endocytosis	TAS
GO:0006911	Process	Phagocytosis, engulfment	ISS
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9468508
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0038024	Function	Cargo receptor activity	ISS
GO:0038187	Function	Pattern recognition receptor activity	TAS	10331948
GO:0043277	Process	Apoptotic cell clearance	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0097242	Process	Amyloid-beta clearance	ISS

Other IDs

• MIM: 604870
• HGNC: 6895
• e!Ensembl: ENSG00000019169

Protein

• UniProt ID: Q9UEW3
• Protein name: Macrophage receptor MARCO (Macrophage receptor with collagenous structure) (Scavenger receptor class A member 2)
• Protein function: Pattern recognition receptor (PRR) which binds Gram-positive and Gram-negative bacteria (PubMed:9468508). Also plays a role in binding of unopsonized particles by alveolar macrophages (By similarity). Binds to the secretoglobin SCGB3A2 (PubMed:1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01391	Collagen	140 → 205	Collagen triple helix repeat (20 copies)	Repeat
  PF01391	Collagen	361 → 423	Collagen triple helix repeat (20 copies)	Repeat
  PF00530	SRCR	427 → 519	Scavenger receptor cysteine-rich domain	Domain

• Sequence:

  MRNKKILKEDELLSETQQAAFHQIAMEPFEINVPKPKRRNGVNFSLAVVVIYLILLTAGA
  GLLVVQVLNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL
  TWVRVSHEHLLQRVDNFTQNPGMFRIKGEQGAPGLQGHKGAMGMPGAPGPPGPPAEKGAK
  GAMGRDGATGPSGPQGPPGVKGEAGLQGPQGAPGKQGATGTPGPQGEKGSKGDGGLIGPK
  GETGTKGEKGDLGLPGSKGDRGMKGDAGVMGPPGAQGSKGDFGRPGPPGLAGFPGAKGDQ
  GQPGLQGVPGPPGAVGHPGAKGEPGSAGSPGRAGLPGSPGSPGATGLKGSKGDTGLQGQQ
  GRKGESGVPGPAGVKGEQGSPGLAGPKGAPGQAGQKGDQGVKGSSGEQGVKGEKGERGEN
  SVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQ
  IWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV

• Sequence length: 520

Pathways

KEGG:

Phagosome

Reactome:

Scavenging by Class A Receptors

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Non-obstructive azoospermia	Non-obstructive azoospermia	rs587777872, rs879253743, rs1600840291, rs1600877766, rs753462162, rs1588618614, rs1602684496, rs377712900	22541561

Unknown
Disease name	Disease term	dbSNP ID	References
Liver carcinoma	Liver carcinoma		28284560