CBLB (Cbl proto-oncogene B)

Gene

• Entrez ID: 868
• Gene name: Cbl proto-oncogene B
• Gene symbol: CBLB
• Synonyms: ADMIO3, Cbl-b, Nbla00127, RNF56
• Chromosome: 3
• Chromosome location: 3q13.11
• Summary: This gene encodes an E3 ubiquitin-protein ligase which promotes proteosome-mediated protein degradation by transferring ubiquitin from an E2 ubiquitin-conjugating enzyme to a substrate. The encoded protein is involved in the regulation of immune response

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT719554	hsa-miR-151a-5p	HITS-CLIP	19536157
MIRT719553	hsa-miR-151b	HITS-CLIP	19536157
MIRT719552	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT719551	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT719550	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT719549	hsa-miR-4635	HITS-CLIP	19536157
MIRT719548	hsa-miR-3150b-3p	HITS-CLIP	19536157
MIRT719547	hsa-miR-4784	HITS-CLIP	19536157
MIRT719546	hsa-miR-765	HITS-CLIP	19536157
MIRT719545	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT719544	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT719543	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT659794	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT659793	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT659792	hsa-miR-516a-3p	HITS-CLIP	23824327
MIRT659791	hsa-miR-516b-3p	HITS-CLIP	23824327
MIRT659789	hsa-miR-7162-5p	HITS-CLIP	23824327
MIRT659790	hsa-miR-3977	HITS-CLIP	23824327
MIRT659788	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT731259	hsa-miR-891b	Luciferase reporter assay, qRT-PCR, Western blot	27494897
MIRT731259	hsa-miR-891b	Luciferase reporter assay, qRT-PCR, Western blot	27494897
MIRT736560	hsa-miR-181a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32612385
MIRT719554	hsa-miR-151a-5p	HITS-CLIP	19536157
MIRT719553	hsa-miR-151b	HITS-CLIP	19536157
MIRT719552	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT719551	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT719550	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT719549	hsa-miR-4635	HITS-CLIP	19536157
MIRT719548	hsa-miR-3150b-3p	HITS-CLIP	19536157
MIRT719547	hsa-miR-4784	HITS-CLIP	19536157
MIRT719546	hsa-miR-765	HITS-CLIP	19536157
MIRT719545	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT719544	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT719543	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT659794	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT659793	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT659792	hsa-miR-516a-3p	HITS-CLIP	23824327
MIRT659791	hsa-miR-516b-3p	HITS-CLIP	23824327
MIRT659789	hsa-miR-7162-5p	HITS-CLIP	23824327
MIRT659790	hsa-miR-3977	HITS-CLIP	23824327
MIRT659788	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT1546209	hsa-miR-1253	CLIP-seq
MIRT1546210	hsa-miR-27a	CLIP-seq
MIRT1546211	hsa-miR-27b	CLIP-seq
MIRT1546212	hsa-miR-3121-5p	CLIP-seq
MIRT1546213	hsa-miR-3973	CLIP-seq
MIRT1546214	hsa-miR-4422	CLIP-seq
MIRT1546215	hsa-miR-513a-5p	CLIP-seq
MIRT1546216	hsa-miR-520g	CLIP-seq
MIRT1546217	hsa-miR-520h	CLIP-seq
MIRT1546218	hsa-miR-580	CLIP-seq
MIRT1546213	hsa-miR-3973	CLIP-seq
MIRT1546214	hsa-miR-4422	CLIP-seq
MIRT1546216	hsa-miR-520g	CLIP-seq
MIRT1546217	hsa-miR-520h	CLIP-seq
MIRT2193971	hsa-miR-1257	CLIP-seq
MIRT2193972	hsa-miR-1285	CLIP-seq
MIRT2193973	hsa-miR-223	CLIP-seq
MIRT2193974	hsa-miR-3187-5p	CLIP-seq
MIRT2193975	hsa-miR-3611	CLIP-seq
MIRT2193976	hsa-miR-3654	CLIP-seq
MIRT2193977	hsa-miR-3661	CLIP-seq
MIRT2193978	hsa-miR-4277	CLIP-seq
MIRT1546214	hsa-miR-4422	CLIP-seq
MIRT2193979	hsa-miR-4535	CLIP-seq
MIRT2193980	hsa-miR-4694-3p	CLIP-seq
MIRT2193981	hsa-miR-4697-3p	CLIP-seq
MIRT2193982	hsa-miR-4712-3p	CLIP-seq
MIRT2193983	hsa-miR-492	CLIP-seq
MIRT2193984	hsa-miR-539	CLIP-seq
MIRT2193985	hsa-miR-548c-3p	CLIP-seq
MIRT2193986	hsa-miR-581	CLIP-seq
MIRT2193987	hsa-miR-612	CLIP-seq
MIRT2193988	hsa-miR-631	CLIP-seq
MIRT2446252	hsa-miR-1323	CLIP-seq
MIRT2446253	hsa-miR-548ac	CLIP-seq
MIRT2446254	hsa-miR-548ae	CLIP-seq
MIRT2446255	hsa-miR-548aj	CLIP-seq
MIRT2446256	hsa-miR-548am	CLIP-seq
MIRT2446257	hsa-miR-548d-3p	CLIP-seq
MIRT2446258	hsa-miR-548o	CLIP-seq
MIRT2446259	hsa-miR-548x	CLIP-seq
MIRT2446260	hsa-miR-548z	CLIP-seq
MIRT1546210	hsa-miR-27a	CLIP-seq
MIRT1546211	hsa-miR-27b	CLIP-seq
MIRT2497313	hsa-miR-30a	CLIP-seq
MIRT2497314	hsa-miR-30b	CLIP-seq
MIRT2497315	hsa-miR-30c	CLIP-seq
MIRT2497316	hsa-miR-30d	CLIP-seq
MIRT2497317	hsa-miR-30e	CLIP-seq
MIRT2497318	hsa-miR-3607-3p	CLIP-seq
MIRT1546213	hsa-miR-3973	CLIP-seq
MIRT1546214	hsa-miR-4422	CLIP-seq
MIRT2497319	hsa-miR-4776-3p	CLIP-seq
MIRT1546215	hsa-miR-513a-5p	CLIP-seq
MIRT1546216	hsa-miR-520g	CLIP-seq
MIRT1546217	hsa-miR-520h	CLIP-seq
MIRT2497320	hsa-miR-548ag	CLIP-seq
MIRT2497321	hsa-miR-548ai	CLIP-seq
MIRT2497322	hsa-miR-548g	CLIP-seq
MIRT2497323	hsa-miR-624	CLIP-seq
MIRT2193973	hsa-miR-223	CLIP-seq
MIRT1546210	hsa-miR-27a	CLIP-seq
MIRT1546211	hsa-miR-27b	CLIP-seq
MIRT2497313	hsa-miR-30a	CLIP-seq
MIRT2497314	hsa-miR-30b	CLIP-seq
MIRT2497315	hsa-miR-30c	CLIP-seq
MIRT2497316	hsa-miR-30d	CLIP-seq
MIRT2497317	hsa-miR-30e	CLIP-seq
MIRT2497318	hsa-miR-3607-3p	CLIP-seq
MIRT1546213	hsa-miR-3973	CLIP-seq
MIRT1546214	hsa-miR-4422	CLIP-seq
MIRT2193981	hsa-miR-4697-3p	CLIP-seq
MIRT2497319	hsa-miR-4776-3p	CLIP-seq
MIRT1546215	hsa-miR-513a-5p	CLIP-seq
MIRT1546216	hsa-miR-520g	CLIP-seq
MIRT1546217	hsa-miR-520h	CLIP-seq
MIRT2497320	hsa-miR-548ag	CLIP-seq
MIRT2497321	hsa-miR-548ai	CLIP-seq
MIRT2497322	hsa-miR-548g	CLIP-seq
MIRT2497323	hsa-miR-624	CLIP-seq
MIRT2677462	hsa-miR-944	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001784	Function	Phosphotyrosine residue binding	IEA
GO:0002669	Process	Positive regulation of T cell anergy	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	10022120, 12177062, 12577067, 16189514, 17020880, 17255943, 18680311, 19268472, 19380743, 20598684, 20936779, 21706016, 21900206, 23663663, 25218436, 25416956, 25814554, 26871637, 27107012, 28514442, 29237719, 29513927, 29997244, 31467278, 31515488, 31980649, 32296183, 32814053
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0006607	Process	NLS-bearing protein import into nucleus	TAS	7784085
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0007175	Process	Negative regulation of epidermal growth factor-activated receptor activity	IBA	21873635
GO:0008270	Function	Zinc ion binding	TAS	7784085
GO:0016567	Process	Protein ubiquitination	IEA
GO:0017124	Function	SH3 domain binding	IBA	21873635
GO:0018193	Process	Peptidyl-amino acid modification	IEA
GO:0030971	Function	Receptor tyrosine kinase binding	IBA	21873635
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042110	Process	T cell activation	IEA
GO:0043087	Process	Regulation of GTPase activity	IEA
GO:0043393	Process	Regulation of protein binding	IEA
GO:0045121	Component	Membrane raft	IBA	21873635
GO:0045732	Process	Positive regulation of protein catabolic process	IEA
GO:0046642	Process	Negative regulation of alpha-beta T cell proliferation	IEA
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA	21873635
GO:2000583	Process	Regulation of platelet-derived growth factor receptor-alpha signaling pathway	ISS

Other IDs

• MIM: 604491
• HGNC: 1542
• e!Ensembl: ENSG00000114423

Protein

• UniProt ID: Q13191
• Protein name: E3 ubiquitin-protein ligase CBL-B (EC 2.3.2.27) (Casitas B-lineage lymphoma proto-oncogene b) (RING finger protein 56) (RING-type E3 ubiquitin transferase CBL-B) (SH3-binding protein CBL-B) (Signal transduction protein CBL-B)
• Protein function: E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfers it to substrates, generally promoting their degradation by the proteasome. Negatively regulates TCR (T-cell receptor), BCR (B-cell
• PDB: 2AK5, 2BZ8, 2DO6, 2J6F, 2JNH, 2LDR, 2OOA, 2OOB, 3PFV, 3VGO, 3ZNI, 8GCY, 8QNG, 8QNH, 8QNI, 8QTG, 8QTH, 8QTJ, 8QTK, 8VW4, 8VW5, 9FQH, 9FQI, 9FQJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02262	Cbl_N	41 → 167	CBL proto-oncogene N-terminal domain 1	Domain
  PF02761	Cbl_N2	171 → 254	CBL proto-oncogene N-terminus, EF hand-like domain	Domain
  PF02762	Cbl_N3	256 → 341	CBL proto-oncogene N-terminus, SH2-like domain	Domain
  PF14447	Prok-RING_4	373 → 426		Family

• Sequence:

  MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
  QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
  AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
  FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
  QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
  TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
  ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
  IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTS
  PGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQ
  DKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFG
  TNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHL
  GSEEYDVPPRLSPPPPVTTLLPSIKCTGPLANSLSEKTRDPVEEDDDEYKIPSSHPVSLN
  SQPSHCHNVKPPVRSCDNGHCMLNGTHGPSSEKKSNIPDLSIYLKGDVFDSASDPVPLPP
  ARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPPG
  SSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQ
  APARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNV
  EVARSILREFAFPPPVSPRLNL

• Sequence length: 982

Pathways

KEGG:

ErbB signaling pathway
Ubiquitin mediated proteolysis
Endocytosis
C-type lectin receptor signaling pathway
T cell receptor signaling pathway
Insulin signaling pathway
Measles

Reactome:

Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Hypothyroidism	Hypothyroidism	rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912, rs121917847, rs104893655, rs104893657, rs104893658, rs104893659, rs104893660, rs104893656, rs121917719, rs786204790, rs189261858, rs879255608, rs868197660, rs879255609, rs1586744173, rs1586182837, rs771222349, rs1587618417, rs1601844140, rs760832986, rs780982673, rs1603336347, rs1691155605	30595370
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601
Multiple sclerosis	Multiple Sclerosis, Multiple Sclerosis, Acute Fulminating	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039, rs483353038, rs61731956, rs568165874, rs767480544	28445677, 20453840, 20453840