GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

SOCS1 (suppressor of cytokine signaling 1)

Gene

8651

Suppressor of cytokine signaling 1

SOCS1

AISIMD, CIS1, CISH1, JAB, SOCS-1, SSI-1, SSI1, TIP-3, TIP3

16p13.13

This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be ind

Show/Hide all(251)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004336	hsa-miR-19b-3p	Luciferase reporter assay, Western blot	18728182
MIRT004337	hsa-miR-19a-3p	Luciferase reporter assay, Western blot	18728182
MIRT000456	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Western blot	20354188
MIRT004337	hsa-miR-19a-3p	Luciferase reporter assay	18728182
MIRT004336	hsa-miR-19b-3p	Luciferase reporter assay	18728182
MIRT000456	hsa-miR-155-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	21355095
MIRT006325	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006325	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006373	hsa-let-7i-5p	Luciferase reporter assay	21742974
MIRT006373	hsa-let-7i-5p	Luciferase reporter assay	21742974
MIRT000456	hsa-miR-155-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	21355095
MIRT006373	hsa-let-7i-5p	Luciferase reporter assay	21742974
MIRT006373	hsa-let-7i-5p	Luciferase reporter assay	21742974
MIRT006325	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006325	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	21355095
MIRT006373	hsa-let-7i-5p	Luciferase reporter assay	21742974
MIRT006373	hsa-let-7i-5p	Luciferase reporter assay	21742974
MIRT006325	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006325	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay	22771905
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay	22771905
MIRT007084	hsa-miR-122-5p	GFP reporter assay	23348614
MIRT007084	hsa-miR-122-5p	GFP reporter assay	23348614
MIRT007084	hsa-miR-122-5p	GFP reporter assay	23348614
MIRT007084	hsa-miR-122-5p	GFP reporter assay	23348614
MIRT007132	hsa-miR-30c-5p	qRT-PCR	23418453
MIRT000456	hsa-miR-155-5p	Proteomics	18668040
MIRT053037	hsa-miR-30d-5p	Luciferase reporter assay, Western blot	23231923
MIRT053037	hsa-miR-30d-5p	Luciferase reporter assay, Western blot	23231923
MIRT053037	hsa-miR-30d-5p	Luciferase reporter assay, Western blot	23231923
MIRT004337	hsa-miR-19a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23621248
MIRT004337	hsa-miR-19a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23621248
MIRT000456	hsa-miR-155-5p	ELISA, Immunoprecipitaion, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23436936
MIRT438547	hsa-miR-221-3p	Luciferase reporter assay, Western blot	25019494
MIRT438547	hsa-miR-221-3p	Luciferase reporter assay, Western blot	25019494
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	24351865
MIRT000456	hsa-miR-155-5p	ELISA, Immunoprecipitaion, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23436936
MIRT438547	hsa-miR-221-3p	Luciferase reporter assay, Western blot	25019494
MIRT438547	hsa-miR-221-3p	Luciferase reporter assay, Western blot	25019494
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	24351865
MIRT492210	hsa-miR-30e-5p	PAR-CLIP	22291592
MIRT053037	hsa-miR-30d-5p	PAR-CLIP	22291592
MIRT492209	hsa-miR-30a-5p	PAR-CLIP	22291592
MIRT006325	hsa-miR-30b-5p	PAR-CLIP	22291592
MIRT007132	hsa-miR-30c-5p	PAR-CLIP	22291592
MIRT004337	hsa-miR-19a-3p	PAR-CLIP	22291592
MIRT004336	hsa-miR-19b-3p	PAR-CLIP	22291592
MIRT492208	hsa-miR-331-3p	PAR-CLIP	22291592
MIRT492205	hsa-miR-4495	PAR-CLIP	22291592
MIRT492204	hsa-miR-379-3p	PAR-CLIP	22291592
MIRT492203	hsa-miR-411-3p	PAR-CLIP	22291592
MIRT492202	hsa-miR-380-3p	PAR-CLIP	22291592
MIRT492201	hsa-miR-8060	PAR-CLIP	22291592
MIRT492200	hsa-miR-6861-5p	PAR-CLIP	22291592
MIRT492199	hsa-miR-29b-1-5p	PAR-CLIP	22291592
MIRT492196	hsa-miR-503-3p	PAR-CLIP	22291592
MIRT492195	hsa-miR-5087	PAR-CLIP	22291592
MIRT492193	hsa-miR-4709-3p	PAR-CLIP	22291592
MIRT492192	hsa-miR-518a-5p	PAR-CLIP	22291592
MIRT492191	hsa-miR-527	PAR-CLIP	22291592
MIRT492190	hsa-miR-2113	PAR-CLIP	22291592
MIRT006373	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT492220	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT492219	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT492218	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT492217	hsa-miR-4500	PAR-CLIP	23592263
MIRT492216	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT492215	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT492214	hsa-miR-4458	PAR-CLIP	23592263
MIRT492213	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT492212	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT492211	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT492210	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT053037	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT492209	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT006325	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT007132	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT004337	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT004336	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT492208	hsa-miR-331-3p	PAR-CLIP	23592263
MIRT492207	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT492206	hsa-miR-4779	PAR-CLIP	23592263
MIRT492205	hsa-miR-4495	PAR-CLIP	23592263
MIRT492204	hsa-miR-379-3p	PAR-CLIP	23592263
MIRT492203	hsa-miR-411-3p	PAR-CLIP	23592263
MIRT492202	hsa-miR-380-3p	PAR-CLIP	23592263
MIRT492201	hsa-miR-8060	PAR-CLIP	23592263
MIRT492200	hsa-miR-6861-5p	PAR-CLIP	23592263
MIRT492199	hsa-miR-29b-1-5p	PAR-CLIP	23592263
MIRT492198	hsa-miR-3689d	PAR-CLIP	23592263
MIRT492197	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT492196	hsa-miR-503-3p	PAR-CLIP	23592263
MIRT492195	hsa-miR-5087	PAR-CLIP	23592263
MIRT492194	hsa-miR-4266	PAR-CLIP	23592263
MIRT492193	hsa-miR-4709-3p	PAR-CLIP	23592263
MIRT492192	hsa-miR-518a-5p	PAR-CLIP	23592263
MIRT492191	hsa-miR-527	PAR-CLIP	23592263
MIRT492190	hsa-miR-2113	PAR-CLIP	23592263
MIRT000456	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT000456	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT004337	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT004336	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT492209	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT006325	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT007132	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT053037	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT492210	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT731736	hsa-miR-142-5p	ChIP-seq, ELISA, EMSA, Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26436920
MIRT731736	hsa-miR-142-5p	ChIP-seq, ELISA, EMSA, Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26436920
MIRT000456	hsa-miR-155-5p	Western blot	27470349
MIRT000456	hsa-miR-155-5p	qRT-PCR, Western blot	25998827
MIRT000456	hsa-miR-155-5p	ELISA, qRT-PCR, Western blot	27817193
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	27811366
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	27811366
MIRT438547	hsa-miR-221-3p	ELISA, Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	33955508
MIRT492219	hsa-let-7b-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33005103
MIRT492219	hsa-let-7b-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33005103
MIRT492210	hsa-miR-30e-5p	Luciferase reporter assay, Immunoprecipitaion (IP), ELISA	32688283
MIRT492219	hsa-let-7b-5p	ELISA, Luciferase reporter assay, qRT-PCR	33005103
MIRT731736	hsa-miR-142-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR, ELISA	31949659
MIRT736464	hsa-miR-222-3p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	31637892
MIRT492210	hsa-miR-30e-5p	PAR-CLIP	22291592
MIRT053037	hsa-miR-30d-5p	PAR-CLIP	22291592
MIRT492209	hsa-miR-30a-5p	PAR-CLIP	22291592
MIRT006325	hsa-miR-30b-5p	PAR-CLIP	22291592
MIRT007132	hsa-miR-30c-5p	PAR-CLIP	22291592
MIRT004337	hsa-miR-19a-3p	PAR-CLIP	22291592
MIRT004336	hsa-miR-19b-3p	PAR-CLIP	22291592
MIRT492208	hsa-miR-331-3p	PAR-CLIP	22291592
MIRT492205	hsa-miR-4495	PAR-CLIP	22291592
MIRT492204	hsa-miR-379-3p	PAR-CLIP	22291592
MIRT492203	hsa-miR-411-3p	PAR-CLIP	22291592
MIRT492202	hsa-miR-380-3p	PAR-CLIP	22291592
MIRT492201	hsa-miR-8060	PAR-CLIP	22291592
MIRT492200	hsa-miR-6861-5p	PAR-CLIP	22291592
MIRT492199	hsa-miR-29b-1-5p	PAR-CLIP	22291592
MIRT492196	hsa-miR-503-3p	PAR-CLIP	22291592
MIRT492195	hsa-miR-5087	PAR-CLIP	22291592
MIRT492193	hsa-miR-4709-3p	PAR-CLIP	22291592
MIRT492192	hsa-miR-518a-5p	PAR-CLIP	22291592
MIRT492191	hsa-miR-527	PAR-CLIP	22291592
MIRT492190	hsa-miR-2113	PAR-CLIP	22291592
MIRT006373	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT492220	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT492219	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT492218	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT492217	hsa-miR-4500	PAR-CLIP	23592263
MIRT492216	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT492215	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT492214	hsa-miR-4458	PAR-CLIP	23592263
MIRT492213	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT492212	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT492211	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT492210	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT053037	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT492209	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT006325	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT007132	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT004337	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT004336	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT492208	hsa-miR-331-3p	PAR-CLIP	23592263
MIRT492207	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT492206	hsa-miR-4779	PAR-CLIP	23592263
MIRT492205	hsa-miR-4495	PAR-CLIP	23592263
MIRT492204	hsa-miR-379-3p	PAR-CLIP	23592263
MIRT492203	hsa-miR-411-3p	PAR-CLIP	23592263
MIRT492202	hsa-miR-380-3p	PAR-CLIP	23592263
MIRT492201	hsa-miR-8060	PAR-CLIP	23592263
MIRT492200	hsa-miR-6861-5p	PAR-CLIP	23592263
MIRT492199	hsa-miR-29b-1-5p	PAR-CLIP	23592263
MIRT492198	hsa-miR-3689d	PAR-CLIP	23592263
MIRT492197	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT492196	hsa-miR-503-3p	PAR-CLIP	23592263
MIRT492195	hsa-miR-5087	PAR-CLIP	23592263
MIRT492194	hsa-miR-4266	PAR-CLIP	23592263
MIRT492193	hsa-miR-4709-3p	PAR-CLIP	23592263
MIRT492192	hsa-miR-518a-5p	PAR-CLIP	23592263
MIRT492191	hsa-miR-527	PAR-CLIP	23592263
MIRT492190	hsa-miR-2113	PAR-CLIP	23592263
MIRT492208	hsa-miR-331-3p	Luciferase reporter assay, Western blotting, qRT-PCR	36199788
MIRT755552	hsa-miR-6794-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP)	38521953
MIRT755606	miR-30d	Western blotting, qRT-PCR, Immunofluorescence	36704201
MIRT1378493	hsa-let-7a	CLIP-seq
MIRT1378494	hsa-let-7b	CLIP-seq
MIRT1378495	hsa-let-7c	CLIP-seq
MIRT1378496	hsa-let-7d	CLIP-seq
MIRT1378497	hsa-let-7e	CLIP-seq
MIRT1378498	hsa-let-7f	CLIP-seq
MIRT1378499	hsa-let-7g	CLIP-seq
MIRT1378500	hsa-let-7i	CLIP-seq
MIRT1378501	hsa-miR-19a	CLIP-seq
MIRT1378502	hsa-miR-19b	CLIP-seq
MIRT1378503	hsa-miR-30a	CLIP-seq
MIRT1378504	hsa-miR-30b	CLIP-seq
MIRT1378505	hsa-miR-30c	CLIP-seq
MIRT1378506	hsa-miR-30d	CLIP-seq
MIRT1378507	hsa-miR-30e	CLIP-seq
MIRT1378508	hsa-miR-324-5p	CLIP-seq
MIRT1378509	hsa-miR-361-3p	CLIP-seq
MIRT1378510	hsa-miR-380	CLIP-seq
MIRT1378511	hsa-miR-495	CLIP-seq
MIRT1378512	hsa-miR-566	CLIP-seq
MIRT1378513	hsa-miR-569	CLIP-seq
MIRT1378514	hsa-miR-922	CLIP-seq
MIRT1378515	hsa-miR-98	CLIP-seq
MIRT2112953	hsa-miR-221	CLIP-seq
MIRT2112954	hsa-miR-222	CLIP-seq
MIRT2112955	hsa-miR-320e	CLIP-seq
MIRT2112956	hsa-miR-548v	CLIP-seq
MIRT2112957	hsa-miR-582-5p	CLIP-seq
MIRT2335849	hsa-miR-149	CLIP-seq
MIRT2112953	hsa-miR-221	CLIP-seq
MIRT2112954	hsa-miR-222	CLIP-seq
MIRT1378503	hsa-miR-30a	CLIP-seq
MIRT1378504	hsa-miR-30b	CLIP-seq
MIRT1378505	hsa-miR-30c	CLIP-seq
MIRT1378506	hsa-miR-30d	CLIP-seq
MIRT1378507	hsa-miR-30e	CLIP-seq
MIRT2112955	hsa-miR-320e	CLIP-seq
MIRT1378510	hsa-miR-380	CLIP-seq
MIRT2112956	hsa-miR-548v	CLIP-seq
MIRT2112957	hsa-miR-582-5p	CLIP-seq
MIRT2112953	hsa-miR-221	CLIP-seq
MIRT2112954	hsa-miR-222	CLIP-seq
MIRT2112955	hsa-miR-320e	CLIP-seq
MIRT2112956	hsa-miR-548v	CLIP-seq
MIRT2112957	hsa-miR-582-5p	CLIP-seq
MIRT1378493	hsa-let-7a	CLIP-seq
MIRT1378494	hsa-let-7b	CLIP-seq
MIRT1378495	hsa-let-7c	CLIP-seq
MIRT1378496	hsa-let-7d	CLIP-seq
MIRT1378497	hsa-let-7e	CLIP-seq
MIRT1378498	hsa-let-7f	CLIP-seq
MIRT1378499	hsa-let-7g	CLIP-seq
MIRT1378500	hsa-let-7i	CLIP-seq
MIRT2335849	hsa-miR-149	CLIP-seq
MIRT1378503	hsa-miR-30a	CLIP-seq
MIRT1378504	hsa-miR-30b	CLIP-seq
MIRT1378505	hsa-miR-30c	CLIP-seq
MIRT1378506	hsa-miR-30d	CLIP-seq
MIRT1378507	hsa-miR-30e	CLIP-seq
MIRT1378510	hsa-miR-380	CLIP-seq
MIRT2112957	hsa-miR-582-5p	CLIP-seq
MIRT1378515	hsa-miR-98	CLIP-seq

Transcription factors

Show/Hide all(7)

Transcription factor	Regulation	Reference
GLI1	Activation	24058673
GLI2	Activation	24058673
HIF1A	Activation	20003295
IRF1	Activation	20644166
SP1	Activation	20644166
STAT3	Activation	14630083;20003295;20357037
STAT6	Unknown	15199062;18342537

Show/Hide all(37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0001932	Process	Regulation of protein phosphorylation	ISS
GO:0004860	Function	Protein kinase inhibitor activity	TAS	9202125
GO:0005159	Function	Insulin-like growth factor receptor binding	IPI	9727029
GO:0005515	Function	Protein binding	IPI	16273093, 16643902, 17183367, 18172216, 23401859, 31980649, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	TAS	9202126
GO:0005829	Component	Cytosol	TAS
GO:0005942	Component	Phosphatidylinositol 3-kinase complex	IBA	21873635
GO:0006469	Process	Negative regulation of protein kinase activity	IEA
GO:0007259	Process	Receptor signaling pathway via JAK-STAT	IEA
GO:0010533	Process	Regulation of activation of Janus kinase activity	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019210	Function	Kinase inhibitor activity	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019901	Function	Protein kinase binding	IPI	9727029
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0038111	Process	Interleukin-7-mediated signaling pathway	TAS
GO:0040008	Process	Regulation of growth	IEA
GO:0042532	Process	Negative regulation of tyrosine phosphorylation of STAT protein	IMP	25019494
GO:0042532	Process	Negative regulation of tyrosine phosphorylation of STAT protein	ISS
GO:0043372	Process	Positive regulation of CD4-positive, alpha-beta T cell differentiation	ISS
GO:0043377	Process	Negative regulation of CD8-positive, alpha-beta T cell differentiation	ISS
GO:0043551	Process	Regulation of phosphatidylinositol 3-kinase activity	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IMP	22387553
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IMP	25019494
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	ISS
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	NAS	9727029
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	ISS
GO:0046854	Process	Phosphatidylinositol phosphorylation	IBA	21873635
GO:0046935	Function	1-phosphatidylinositol-3-kinase regulator activity	IBA	21873635
GO:0060334	Process	Regulation of interferon-gamma-mediated signaling pathway	TAS
GO:0071230	Process	Cellular response to amino acid stimulus	IEA

MIM	HGNC	e!Ensembl
603597	19383	ENSG00000185338

Protein

UniProt ID

O15524

Protein name

Suppressor of cytokine signaling 1 (SOCS-1) (JAK-binding protein) (JAB) (STAT-induced STAT inhibitor 1) (SSI-1) (Tec-interacting protein 3) (TIP-3)

Protein function

Essential negative regulator of type I and type II interferon (IFN) signaling, as well as that of other cytokines, including IL2, IL4, IL6 and leukemia inhibitory factor (LIF) (PubMed:32499645, PubMed:33087723). Downregulates cytokine signaling

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00017	SH2	79 → 154	SH2 domain	Domain

Sequence

MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRS
HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA
SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQ
RIVATVGRENLARIPLNPVLRDYLSSFPFQI

Sequence length

211

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis Osteoclast differentiation JAK-STAT signaling pathway Insulin signaling pathway Prolactin signaling pathway Type II diabetes mellitus Growth hormone synthesis, secretion and action Toxoplasmosis MicroRNAs in cancer		Interleukin-7 signaling MyD88:MAL(TIRAP) cascade initiated on plasma membrane Interleukin-4 and Interleukin-13 signaling Interferon gamma signaling Regulation of IFNG signaling Interferon alpha/beta signaling Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Show/Hide Causal Diseases (2)

Causal
Disease name	Disease term	dbSNP ID	References
Dermatitis	Dermatitis, Allergic Contact	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	16033404
Lymphoma	Lymphoma	rs11540652, rs1592119138, rs1592123162, rs1599367044

Show/Hide Unknown Diseases (2)

Unknown
Disease name	Disease term	dbSNP ID	References
B-cell lymphoma	B-Cell Lymphomas
Hodgkin disease	Hodgkin Disease

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412