AKR1C3 (aldo-keto reductase family 1 member C3)

Gene

• Entrez ID: 8644
• Gene name: Aldo-keto reductase family 1 member C3
• Gene symbol: AKR1C3
• Synonyms: DD3, DDX, HA1753, HAKRB, HAKRe, HSD17B5, PGFS, hluPGFS
• Chromosome: 10
• Chromosome location: 10p15.1
• Summary: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020887	hsa-miR-155-5p	Proteomics	18668040
MIRT027720	hsa-miR-98-5p	Microarray	19088304
MIRT776290	hsa-miR-1207-3p	CLIP-seq
MIRT776291	hsa-miR-184	CLIP-seq
MIRT776292	hsa-miR-190	CLIP-seq
MIRT776293	hsa-miR-190b	CLIP-seq
MIRT776294	hsa-miR-198	CLIP-seq
MIRT776295	hsa-miR-3136-5p	CLIP-seq
MIRT776296	hsa-miR-3689a-5p	CLIP-seq
MIRT776297	hsa-miR-3689b	CLIP-seq
MIRT776298	hsa-miR-3689e	CLIP-seq
MIRT776299	hsa-miR-3689f	CLIP-seq
MIRT776300	hsa-miR-4439	CLIP-seq
MIRT776301	hsa-miR-4513	CLIP-seq
MIRT776302	hsa-miR-4700-3p	CLIP-seq
MIRT776303	hsa-miR-4703-3p	CLIP-seq
MIRT776304	hsa-miR-512-5p	CLIP-seq
MIRT776305	hsa-miR-562	CLIP-seq
MIRT776306	hsa-miR-943	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AR	Repression	22971343

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001523	Process	Retinoid metabolic process	TAS
GO:0001758	Function	Retinal dehydrogenase activity	IDA	21851338
GO:0004032	Function	Alditol:NADP+ 1-oxidoreductase activity	IBA	21873635
GO:0004032	Function	Alditol:NADP+ 1-oxidoreductase activity	IDA	21232532
GO:0004033	Function	Aldo-keto reductase (NADP) activity	TAS	9792917
GO:0004303	Function	Estradiol 17-beta-dehydrogenase activity	IEA
GO:0004745	Function	Retinol dehydrogenase activity	IDA	21851338
GO:0005634	Component	Nucleus	IDA	18574251
GO:0005737	Component	Cytoplasm	IDA	18574251, 19336506, 19942269, 22170488
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006693	Process	Prostaglandin metabolic process	IBA	21873635
GO:0006693	Process	Prostaglandin metabolic process	IEP	20036328
GO:0006693	Process	Prostaglandin metabolic process	TAS	9792917
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	18508192
GO:0007584	Process	Response to nutrient	IEP	19007764
GO:0008202	Process	Steroid metabolic process	IBA	21873635
GO:0008202	Process	Steroid metabolic process	IEP	20036328
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	18508192, 20036328
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	21851338
GO:0008584	Process	Male gonad development	IEP	19942269
GO:0009267	Process	Cellular response to starvation	IEP	18641923
GO:0010942	Process	Positive regulation of cell death	IDA	21787718
GO:0016229	Function	Steroid dehydrogenase activity	IBA	21873635
GO:0016488	Process	Farnesol catabolic process	IDA	21187079
GO:0016655	Function	Oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	IDA	19442656, 20837989
GO:0018636	Function	Phenanthrene 9,10-monooxygenase activity	IDA	21851338
GO:0019371	Process	Cyclooxygenase pathway	TAS
GO:0030216	Process	Keratinocyte differentiation	IEP	22170488
GO:0032052	Function	Bile acid binding	IBA	21873635
GO:0034614	Process	Cellular response to reactive oxygen species	IDA	21787718
GO:0035410	Function	Dihydrotestosterone 17-beta-dehydrogenase activity	IDA	16983398
GO:0036130	Function	Prostaglandin H2 endoperoxidase reductase activity	TAS
GO:0036131	Function	Prostaglandin D2 11-ketoreductase activity	TAS
GO:0042448	Process	Progesterone metabolic process	IBA	21873635
GO:0042448	Process	Progesterone metabolic process	IDA	21232532
GO:0042572	Process	Retinol metabolic process	IEA
GO:0042574	Process	Retinal metabolic process	IDA	21851338
GO:0043170	Process	Macromolecule metabolic process	IEP	18641923
GO:0044597	Process	Daunorubicin metabolic process	IBA	21873635
GO:0044597	Process	Daunorubicin metabolic process	IMP	20837989
GO:0044598	Process	Doxorubicin metabolic process	IBA	21873635
GO:0044598	Process	Doxorubicin metabolic process	IMP	20837989
GO:0045550	Function	Geranylgeranyl reductase activity	IDA	21187079
GO:0045703	Function	Ketoreductase activity	IDA	19487289
GO:0047017	Function	Prostaglandin-F synthase activity	IEA
GO:0047020	Function	15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity	IDA	22170488
GO:0047023	Function	Androsterone dehydrogenase activity	IBA	21873635
GO:0047023	Function	Androsterone dehydrogenase activity	IDA	16983398
GO:0047024	Function	5alpha-androstane-3beta,17beta-diol dehydrogenase activity	IEA
GO:0047035	Function	Testosterone dehydrogenase (NAD+) activity	IEA
GO:0047044	Function	Androstan-3-alpha,17-beta-diol dehydrogenase activity	IEA
GO:0047045	Function	Testosterone 17-beta-dehydrogenase (NADP+) activity	IEA
GO:0047086	Function	Ketosteroid monooxygenase activity	IBA	21873635
GO:0047086	Function	Ketosteroid monooxygenase activity	IDA	21232532
GO:0047787	Function	Delta4-3-oxosteroid 5beta-reductase activity	IDA	16983398
GO:0048385	Process	Regulation of retinoic acid receptor signaling pathway	IDA	21851338
GO:0051897	Process	Positive regulation of protein kinase B signaling	IDA	18508192
GO:0052650	Function	NADP-retinol dehydrogenase activity	TAS
GO:0061370	Process	Testosterone biosynthetic process	IMP	16983398
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070293	Process	Renal absorption	NAS	16157291
GO:0071276	Process	Cellular response to cadmium ion	IDA	21787718
GO:0071277	Process	Cellular response to calcium ion	IDA	22170488
GO:0071379	Process	Cellular response to prostaglandin stimulus	IDA	22170488
GO:0071384	Process	Cellular response to corticosteroid stimulus	IDA	19336506
GO:0071395	Process	Cellular response to jasmonic acid stimulus	IDA	19487289
GO:0071799	Process	Cellular response to prostaglandin D stimulus	IDA	18508192
GO:1900053	Process	Negative regulation of retinoic acid biosynthetic process	IDA	21851338
GO:2000224	Process	Regulation of testosterone biosynthetic process	IMP	19336506
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IDA	19442656
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IDA	19442656

Other IDs

• MIM: 603966
• HGNC: 386
• e!Ensembl: ENSG00000196139

Protein

• UniProt ID: P42330
• Protein name: Aldo-keto reductase family 1 member C3 (EC 1.1.1.-) (EC 1.1.1.210) (EC 1.1.1.53) (EC 1.1.1.62) (17-beta-hydroxysteroid dehydrogenase type 5) (17-beta-HSD 5) (3-alpha-HSD type II, brain) (3-alpha-hydroxysteroid dehydrogenase type 2) (3-alpha-HSD type 2) (E
• Protein function: Cytosolic aldo-keto reductase that catalyzes the NADH and NADPH-dependent reduction of ketosteroids to hydroxysteroids. Acts as a NAD(P)(H)-dependent 3-, 17- and 20-ketosteroid reductase on the steroid nucleus and side chain and regulates the me
• PDB: 1RY0, 1RY8, 1S1P, 1S1R, 1S2A, 1S2C, 1XF0, 1ZQ5, 2F38, 2FGB, 3R43, 3R58, 3R6I, 3R7M, 3R8G, 3R8H, 3R94, 3UFY, 3UG8, 3UGR, 3UWE, 4DBS, 4DBU, 4DBW, 4DZ5, 4FA3, 4FAL, 4FAM, 4H7C, 4HMN, 4WDT, 4WDU, 4WDW, 4WDX, 4WRH, 4XVD, 4XVE, 4YVV, 4YVX, 4ZFC, 5HNT, 5HNU, 6A7B, 6F2U, 6F78, 6GXK, 7C7F, 7C7G, 7C7H, 7WQM, 7WQR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00248	Aldo_ket_red	18 → 301	Aldo/keto reductase family	Domain

• Sequence:

  MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
  VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM
  SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
  GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV
  LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
  RNLHYFNSDSFASHPNYPYSDEY

• Sequence length: 323

Pathways

KEGG:

Steroid hormone biosynthesis
Arachidonic acid metabolism
Folate biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Chemical carcinogenesis - reactive oxygen species

Reactome:

Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol
Synthesis of bile acids and bile salts via 24-hydroxycholesterol
Synthesis of bile acids and bile salts via 27-hydroxycholesterol
Synthesis of Prostaglandins (PG) and Thromboxanes (TX)
RA biosynthesis pathway
Retinoid metabolism and transport

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Endometrial carcinoma	Endometrial Carcinoma	rs34612342, rs587776667, rs587776701, rs63750955, rs587776706, rs121434629, rs80359605, rs121913530, rs104894365, rs79184941, rs121913478, rs63750781, rs193922343, rs267608094, rs267608077, rs587779206, rs63750439, rs63751405, rs63750741, rs63750854, rs63750909, rs587779212, rs63749874, rs267608076, rs587779220, rs63750735, rs267608082, rs587779227, rs267608068, rs63750075, rs587779232, rs267608058, rs63751127, rs63750138, rs267608065, rs63751017, rs587779246, rs63750111, rs63750563, rs267608073, rs63751407, rs63749999, rs267608042, rs63750833, rs587779255, rs587779256, rs267608078, rs267608092, rs587779263, rs267608098, rs587779267, rs63750194, rs63751327, rs63751328, rs587779284, rs63749942, rs63751058, rs267608114, rs267608118, rs63751319, rs267608128, rs1553333594, rs267608126, rs63750767, rs267608120, rs267608121, rs267608122, rs63750342, rs63749873, rs587779318, rs63750019, rs63749980, rs267608048, rs1553412283, rs146816935, rs63750855, rs63751711, rs267607789, rs587779094, rs63750224, rs267607972, rs63750084, rs587779185, rs587778617, rs398123231, rs398123232, rs398123318, rs587780021, rs63750119, rs267608064, rs587781490, rs587781558, rs587781691, rs63749821, rs587782111, rs587782326, rs587782704, rs587779264, rs587779333, rs587782712, rs587783056, rs730881825, rs730881827, rs730881829, rs730881830, rs786202193, rs587782281, rs786202848, rs786201049, rs750528093, rs786202108, rs267608083, rs786201050, rs786203924, rs587781544, rs786201084, rs1553333738, rs863224829, rs863225398, rs863225409, rs863225412, rs864622041, rs869312769, rs869312770, rs63751077, rs876661205, rs876661025, rs63749919, rs876661073, rs876661222, rs267608041, rs878853702, rs751326348, rs866260675, rs886039666, rs886044911, rs1057517552, rs1057517764, rs1057517763, rs121909224, rs1057520605, rs1060502885, rs1060502918, rs1060502932, rs587779215, rs1060502937, rs1060502886, rs1060502875, rs1060502881, rs267607939, rs1023534466, rs1064793600, rs1064795256, rs1064795591, rs1064794055, rs1064794164, rs1553414010, rs1064793671, rs1064794302, rs1064793489, rs1064794384, rs1064793781, rs1553333500, rs760190301, rs1114167719, rs1114167776, rs1114167704, rs1114167748, rs1114167731, rs753796271, rs267608055, rs1114167746, rs1114167715, rs587782706, rs1114167750, rs1114167765, rs1114167747, rs786204048, rs1114167707, rs1114167767, rs1114167717, rs1114167783, rs1553412966, rs1553333598, rs587779297, rs1554294505, rs988423880, rs1554306353, rs1553408136, rs1553333321, rs1553408388, rs63749973, rs1553412064, rs1553412120, rs1553826166, rs1553413784, rs1553331242, rs1553414519, rs1564568660, rs1558392033, rs878853704, rs765763906, rs1558663559, rs1572720704, rs63750985, rs1572727440, rs587779253, rs1580538168, rs149350323, rs374133543, rs771721952, rs201033017, rs763478027, rs1475633334, rs1580553624, rs1580553669, rs578113271, rs757194485, rs539295465, rs778610412, rs758191157, rs1580597397, rs1580033751, rs751236312, rs376667075, rs1561486630, rs1561486632, rs777054839, rs1204002507, rs766672143, rs1580091499, rs1386063673, rs1450314617, rs1580027713, rs367544716, rs1488467945, rs1580053768, rs1580553607, rs1572720794, rs1572722039, rs1572723786, rs1572725235, rs1572728112, rs1175196087, rs1572741984, rs1580540688, rs1259647122, rs1580546793, rs1234762807, rs1580556516, rs1669245178, rs1669365820, rs756190979, rs371356175, rs766997264, rs1743353294, rs1379605717, rs770330684, rs1462955256, rs1744356274, rs1480047980, rs1744149615	16338060
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802, rs28933369, rs121912469, rs80358011, rs397507262, rs80359439, rs397507333, rs80359543, rs80358831, rs80359596, rs80358920, rs80358972, rs80359659, rs397507404, rs397514661, rs80359516, rs200495564, rs80358419, rs80359274, rs80359283, rs80358427, rs80358428, rs80358435, rs81002805, rs397507660, rs397507663, rs80359391, rs80359443, rs81002797, rs80359466, rs397507752, rs80359484, rs80359603, rs397507954, rs80359058, rs80359071, rs397507981, rs80359121, rs80357086, rs80357064, rs397508936, rs80357695, rs80357661, rs397509035, rs80357544, rs80357577, rs80357881, rs80357296, rs80356923, rs80356866, rs80357504, rs80357390, rs80357239, rs80358099, rs397509284, rs80357258, rs199474738, rs199474747, rs587779204, rs63750439, rs267608076, rs587779246, rs63749999, rs267608078, rs63751327, rs267607719, rs267607734, rs63750706, rs63751711, rs587779047, rs587779075, rs267607949, rs63750633, rs63750803, rs63751618, rs267608154, rs200640585, rs80358018, rs80357857, rs80357882, rs180177103, rs587779815, rs587779865, rs587779872, rs587780059, rs121912666, rs587780088, rs587780104, rs200432447, rs180177100, rs587780226, rs587780784, rs587776416, rs587781276, rs587781629, rs587781694, rs587781727, rs587781730, rs587781807, rs587781894, rs587781948, rs121913344, rs587782292, rs587782350, rs587782558, rs587782719, rs587782885, rs587783057, rs730881833, rs730881411, rs730881336, rs139770721, rs730881869, rs730881633, rs730882007, rs786203115, rs765123255, rs1553333738, rs762083530, rs786202800, rs17174393, rs55996097, rs750621215, rs786203451, rs747604569, rs764389018, rs786204433, rs786204862, rs772821016, rs779582317, rs863225406, rs193922343, rs759965045, rs63749919, rs760228510, rs746481984, rs762307622, rs876659736, rs876660933, rs747727055, rs1450394308, rs876658348, rs876658431, rs876659326, rs876660444, rs730881369, rs878853865, rs753862052, rs587780024, rs138941496, rs886040739, rs886040744, rs886040347, rs878854957, rs886040123, rs398122662, rs886040942, rs1057517104, rs1057516320, rs1057516683, rs879254046, rs1057517253, rs587781927, rs985033810, rs1057519989, rs775464903, rs374230313, rs758304323, rs1060501599, rs758081262, rs1060500126, rs1060502734, rs587776408, rs1060501695, rs1114167816, rs1114167596, rs1114167667, rs1555460315, rs1135402788, rs1554086196, rs730881919, rs773356478, rs769237459, rs1553653158, rs587782087, rs1555107263, rs1555119940, rs1403784434, rs1342519012, rs751710099, rs1553616361, rs1553619721, rs1270783041, rs775036118, rs1555288557, rs1555460548, rs1555461154, rs1298667185, rs1553622218, rs63751101, rs1349928568, rs771936821, rs1021662947, rs1555921011, rs81002831, rs1555124506, rs1555574803, rs1060502716, rs1555605362, rs747057367, rs1565385010, rs1567554500, rs1567516230, rs1558644995, rs1555591308, rs778306619, rs1566231194, rs1603328466, rs1570406302, rs1586108714, rs768362387, rs1597713777, rs1060502926, rs1597867185, rs1591517571, rs1591663236, rs1593903006, rs1555284779, rs1597096243, rs45459799, rs1597360340, rs587781905, rs864622481, rs1601753141, rs1966858562, rs1966967065, rs1967016153, rs1967113484, rs2080473458, rs1591387978, rs1224428422, rs1597747184, rs2082309297, rs2051929740, rs147542208	19424620
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	20882379
Ovarian cancer	Epithelial ovarian cancer	rs34424986, rs137853060, rs28934575, rs79658334, rs121913021, rs62625308, rs80356898, rs80357579, rs41293497, rs80356904, rs80357471, rs80357522, rs80357234, rs80357912, rs80357828, rs80357208, rs55770810, rs80358165, rs80358010, rs587780226, rs536907995, rs139414606, rs371638537, rs574552037, rs730881647, rs747993448, rs786202125, rs786202962, rs121913321, rs189261858, rs869320800, rs753023295, rs779466229, rs752411477, rs80357438, rs191486604, rs760874290, rs752780954, rs760782298, rs1555591361, rs1555578360, rs1555588460, rs1555587401, rs747427602, rs112675807, rs80357393	31469419
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17507624, 18306354
Pseudohermaphroditism	Pseudohermaphroditism	rs119481075, rs119481076, rs119481077, rs201115371, rs144809928, rs750481017, rs372027264, rs773720185, rs1554694264, rs1554694678, rs747724352, rs767765046, rs149607031, rs1554705693	25304492

Unknown
Disease name	Disease term	dbSNP ID	References
Ambiguous genitalia	Ambiguous Genitalia	rs782562963	25304492
Endometrial neoplasms	Endometrial Neoplasms		16338060
Endometrioma	Endometrioma		25446850, 21232532
Endometriosis	Endometriosis	rs1800629, rs1143634	25446850, 21232532
Hermaphroditism	Hermaphroditism		25304492
Disorder of sex development	Intersex Conditions		25304492
Sclerocystic ovaries	Sclerocystic Ovaries		22381227, 21262361, 16263811
Polycystic ovary syndrome	Polycystic Ovary Syndrome		21262361, 16263811, 22381227
Prostatic neoplasms	Prostatic Neoplasms		17507624, 18306354
Prostatic cancer, castration-resistant	Prostatic Cancer, Castration-Resistant		25555457
Prostatic neoplasms, castration-resistant	Prostatic Neoplasms, Castration-Resistant		25555457
Sex differentiation disorders	Sex Differentiation Disorders		25304492
Stomach neoplasms	Malignant neoplasm of stomach, Stomach Neoplasms		19424620