GediPNet logo

RUNX3 (RUNX family transcription factor 3)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
864
Gene nameGene Name - the full gene name approved by the HGNC.
RUNX family transcription factor 3
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
RUNX3
SynonymsGene synonyms aliases
AML2, CBFA3, PEBP2aC
ChromosomeChromosome number
1
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.11
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the runt domain-containing family of transcription factors. A heterodimer of this protein and a beta subunit forms a complex that binds to the core DNA sequence 5`-PYGPYGGT-3` found in a number of enhancers and promoters, and
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000038 hsa-miR-532-5p Review 20026422
MIRT003316 hsa-miR-130b-3p qRT-PCR, Western blot 20176475
MIRT000038 hsa-miR-532-5p Flow, qRT-PCR 19336521
MIRT007055 hsa-miR-130a-3p Luciferase reporter assay, Western blot 22846564
MIRT007295 hsa-miR-301a-3p Luciferase reporter assay, qRT-PCR, Western blot 23338485
Transcription factors
Transcription factor Regulation Reference
CBFB Unknown 24648201
DNMT1 Unknown 22274925
EHMT2 Activation 18850007
EZH2 Repression 18430739;20631058;22222375
HDAC1 Activation 18850007
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000785 Component Chromatin ISA
GO:0000785 Component Chromatin ISS
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding ISS
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q13761
Protein name Runt-related transcription factor 3 (Acute myeloid leukemia 2 protein) (Core-binding factor subunit alpha-3) (CBF-alpha-3) (Oncogene AML-2) (Polyomavirus enhancer-binding protein 2 alpha C subunit) (PEA2-alpha C) (PEBP2-alpha C) (SL3-3 enhancer factor 1 a
Protein function Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'-TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their r
PDB 5W69
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00853 Runt
55 184
Runt domain
Domain
PF08504 RunxI
316 415
Runx inhibition domain
Family
Sequence
MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLA
DHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAE
LRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREP
RRHR
QKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELN
PFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPAT
SRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRM
LASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY
Sequence length 415
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Th1 and Th2 cell differentiation
Epstein-Barr virus infection
  Binding of TCF/LEF:CTNNB1 to target gene promoters
RUNX3 regulates CDKN1A transcription
RUNX3 regulates NOTCH signaling
Regulation of RUNX3 expression and activity
RUNX3 Regulates Immune Response and Cell Migration
RUNX3 regulates WNT signaling
RUNX3 regulates YAP1-mediated transcription
RUNX3 regulates RUNX1-mediated transcription
RUNX3 regulates p14-ARF
RUNX3 regulates BCL2L11 (BIM) transcription
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Adenocarcinoma Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular rs121913530, rs886039394, rs121913474 21552421
Asthma Asthma rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283 31619474, 29785011
Carcinoma Carcinoma, Cribriform, Carcinoma, Granular Cell rs121912654, rs555607708, rs786202962, rs1564055259 21552421
Esophagus neoplasm Esophageal Neoplasms, Malignant neoplasm of esophagus rs28934578, rs121918714, rs1567556006, rs1575166666 18058463
Unknown
Disease name Disease term dbSNP ID References
Alopecia Alopecia 28196072
Ankylosing spondylitis Ankylosing spondylitis 21743469
Celiac disease Celiac Disease rs2305764, rs35218876 20190752
Digestive system neuroendocrine neoplasm Gastro-enteropancreatic neuroendocrine tumor 29915428

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412