UNC5C (unc-5 netrin receptor C)

Gene

• Entrez ID: 8633
• Gene name: Unc-5 netrin receptor C
• Gene symbol: UNC5C
• Synonyms: UNC5H3
• Chromosome: 4
• Chromosome location: 4q22.3
• Summary: This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017932	hsa-miR-335-5p	Microarray	18185580
MIRT444568	hsa-miR-4477b	PAR-CLIP	22100165
MIRT444569	hsa-miR-488-3p	PAR-CLIP	22100165
MIRT444570	hsa-miR-4496	PAR-CLIP	22100165
MIRT444571	hsa-miR-323a-3p	PAR-CLIP	22100165
MIRT444572	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT495563	hsa-miR-6762-3p	PAR-CLIP	22291592
MIRT495564	hsa-miR-93-3p	PAR-CLIP	22291592
MIRT495565	hsa-miR-4478	PAR-CLIP	22291592
MIRT495566	hsa-miR-4419b	PAR-CLIP	22291592
MIRT495567	hsa-miR-3929	PAR-CLIP	22291592
MIRT495568	hsa-miR-500a-5p	PAR-CLIP	22291592
MIRT495569	hsa-miR-222-5p	PAR-CLIP	22291592
MIRT495570	hsa-miR-6806-5p	PAR-CLIP	22291592
MIRT495571	hsa-miR-5088-3p	PAR-CLIP	22291592
MIRT495572	hsa-miR-3129-5p	PAR-CLIP	22291592
MIRT495573	hsa-miR-199b-3p	PAR-CLIP	22291592
MIRT495574	hsa-miR-199a-3p	PAR-CLIP	22291592
MIRT495575	hsa-miR-936	PAR-CLIP	22291592

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005042	Function	Netrin receptor activity	IBA	21873635
GO:0005043	Function	Netrin receptor activity involved in chemorepulsion	ISS
GO:0005515	Function	Protein binding	IPI	22685302, 28483977
GO:0005886	Component	Plasma membrane	IDA	25419706
GO:0006915	Process	Apoptotic process	IEA
GO:0007411	Process	Axon guidance	IBA	21873635
GO:0007420	Process	Brain development	IEA
GO:0009986	Component	Cell surface	IEA
GO:0015631	Function	Tubulin binding	IPI	28483977
GO:0016021	Component	Integral component of membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	27068745
GO:0030027	Component	Lamellipodium	ISS
GO:0030175	Component	Filopodium	ISS
GO:0030334	Process	Regulation of cell migration	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030426	Component	Growth cone	ISS
GO:0033564	Process	Anterior/posterior axon guidance	IEA
GO:0038007	Process	Netrin-activated signaling pathway	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0045202	Component	Synapse	IEA
GO:0061643	Process	Chemorepulsion of axon	ISS
GO:1990791	Process	Dorsal root ganglion development	IDA	28483977

Other IDs

• MIM: 603610
• HGNC: 12569
• e!Ensembl: ENSG00000182168

Protein

• UniProt ID: O95185
• Protein name: Netrin receptor UNC5C (Protein unc-5 homolog 3) (Protein unc-5 homolog C)
• Protein function: Receptor for netrin required for axon guidance (By similarity). Mediates axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding (By similarity). NTN1/Netrin-1 binding might cause dissociation of UNC5C from polymerized TUBB3 in microtubules and thereby lead to increased microtubule dynamics and axon repulsion (PubMed:28483977). Axon repulsion in growth cones may also be caused by its association with DCC that may trigger signaling for repulsion (By similarity). Might also collaborate with DSCAM in NTN1-mediated axon repulsion independently of DCC (By similarity). Also involved in corticospinal tract axon guidance independently of DCC (By similarity). Involved in dorsal root ganglion axon projection towards the spinal cord (PubMed:28483977). It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07679	I-set	167 → 257	Immunoglobulin I-set domain	Domain
  PF00090	TSP_1	264 → 313	Thrombospondin type 1 domain	Domain
  PF00090	TSP_1	317 → 367	Thrombospondin type 1 domain	Domain
  PF00791	ZU5	531 → 628	ZU5 domain	Family
  PF17217	UPA	678 → 817	UPA domain	Domain
  PF00531	Death	849 → 928	Death domain	Domain

• Sequence:

  MRKGLRATAARCGLGLGYLLQMLVLPALALLSASGTGSAAQDDDFFHELPETFPSDPPEP
  LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVR
  EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSL
  EQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCV
  AKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCE
  GQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSK
  NCTDGLCMQTAPDSDDVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALN
  GGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIK
  VYNTSGAVTPQDDLSEFTSKLSPQMTQSLLENEALSLKNQSLARQTDPSCTAFGSFNSLG
  GHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGAL
  LTRPVVLTMHHCADPNTEDWKILLKNQAAQGQWEDVVVVGEENFTTPCYIQLDAEACHIL
  TENLSTYALVGHSTTKAAAKRLKLAIFGPLCCSSLEYSIRVYCLDDTQDALKEILHLERQ
  MGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVWSGSQRNLHCT
  FTLERFSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPANTITTVTGPS
  AFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQN
  FPDGNLSMLAAVLEEMGRHETVVSLAAEGQY

• Sequence length: 931

Pathways

KEGG:

Axon guidance

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs-1, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	24956103
Papillary renal carcinoma	Papillary Renal Cell Carcinoma	rs5030823, rs2137087134, rs121913668, rs121913669, rs121913670, rs121913671, rs121913673, rs121913243, rs786202724	21600761
Chromophobe carcinoma	Chromophobe Renal Cell Carcinoma	rs-1	21600761
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs-1, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	29212778
Alzheimer disease	Alzheimer`s Disease	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039, rs63750973, rs63749810, rs63750643, rs-1, rs193922916, rs63750306, rs63750590, rs63750526, rs63751235, rs661, rs63751037, rs63749885, rs63750231, rs63751229, rs63751272, rs63751223, rs63750391, rs63751163, rs281875357, rs63751141, rs63750082, rs121917807, rs63751399, rs63750265, rs63751144, rs63750886, rs63751068, rs121917808, rs63749891, rs63750083, rs63749824, rs63750577, rs267606983, rs63750218, rs63751287, rs63750900, rs145518263, rs63751475, rs63750450, rs63749805, rs63751278, rs63751106, rs63750004, rs63749806, rs63751024, rs63750248, rs63750779, rs63751139, rs63750219, rs63750298, rs63750687, rs63750851, rs1553268799, rs1561901881, rs1561905293, rs866101707, rs1566638673, rs63750009, rs1566656702, rs1566657804, rs1567885728, rs1568339995, rs1566630791, rs1555358260, rs63750964, rs1594998354, rs63751316	27068745, 25419706
Renal carcinoma	Renal Cell Carcinoma, Conventional (Clear Cell) Renal Cell Carcinoma, Sarcomatoid Renal Cell Carcinoma, Collecting Duct Carcinoma of the Kidney	rs121913668, rs121913670, rs121913243, rs786202724	21600761
Arthritis	Degenerative polyarthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	22763110

Unknown
Disease name	Disease term	dbSNP ID	References
Cardiovascular diseases	Cardiovascular Diseases		30595370