GediPNet logo

RFXANK (regulatory factor X associated ankyrin containing protein)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8625
Gene nameGene Name - the full gene name approved by the HGNC.
Regulatory factor X associated ankyrin containing protein
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
RFXANK
SynonymsGene synonyms aliases
ANKRA1, BLS, F14150_1, MHC2D2, RFX-B
ChromosomeChromosome number
19
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.11
SummarySummary of gene provided in NCBI Entrez Gene.
Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated protein and regulatory facto
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104894709 A>T Pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs751386365 T>C Likely-pathogenic Coding sequence variant, missense variant
rs753338285 AT>- Likely-pathogenic Frameshift variant, coding sequence variant
rs759667201 G>A,C Pathogenic Splice donor variant
rs869312922 G>T Pathogenic Splice donor variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT439777 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT439776 hsa-miR-20a-5p HITS-CLIP 22473208
MIRT439777 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT726753 hsa-miR-17-5p HITS-CLIP 22473208
MIRT726752 hsa-miR-20b-5p HITS-CLIP 22473208
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 9806546
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 9806546
GO:0005634 Component Nucleus IBA 21873635
GO:0005654 Component Nucleoplasm IDA
GO:0005829 Component Cytosol IDA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID O14593
Protein name DNA-binding protein RFXANK (Ankyrin repeat family A protein 1) (Regulatory factor X subunit B) (RFX-B) (Regulatory factor X-associated ankyrin-containing protein)
Protein function Activates transcription from class II MHC promoters. Activation requires the activity of the MHC class II transactivator/CIITA. May regulate other genes in the cell. RFX binds the X1 box of MHC-II promoters (PubMed:10072068, PubMed:10725724, Pub
PDB 3UXG , 3V30 , 6MEW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00023 Ank
123 155
Ankyrin repeat
Repeat
PF00023 Ank
189 221
Ankyrin repeat
Repeat
Sequence
MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPVNPEPDASVSS
PQAGSSLKHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELDQLKEHLRKGDNLVNKP
DERGFTPLIWASAFGEIETVRFLLEWGADPHILAKERESALSLASTGGYTDIVGLLLERD
VDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQ
VIENHILKLFQSNLVPADPE
Sequence length 260
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
  Antigen processing and presentation
Tuberculosis
Primary immunodeficiency
 
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Agammaglobulinemia Agammaglobulinemia rs2134166251, rs128620183, rs128620185, rs128621193, rs128621201, rs128621204, rs121912424, rs267606711, rs376256147, rs281865422, rs1600631593, rs1555843601, rs267606871, rs879255271, rs2142904392, rs1555976766, rs1555977461, rs1555977580, rs1555977592, rs1555977598, rs1555978024, rs1555978197, rs1555978277, rs1555978891, rs1555980049, rs1555980799, rs1555980866, rs1554906579, rs1568801716, rs1565638431, rs2095906547, rs2095906404
Neutropenia Neutropenia rs879253882
Pancytopenia Pancytopenia rs869312883, rs770551610, rs1131690788, rs530073586, rs374333820
Unknown
Disease name Disease term dbSNP ID References
Autoimmune hemolytic anemia Autoimmune hemolytic anemia
Bare lymphocyte syndrome Bare lymphocyte syndrome 2, Immunodeficiency by defective expression of MHC class II, Bare Lymphocyte Syndrome, Type II, Complementation Group B 10072068, 22649097, 9806546, 10725724
Cholangitis Cholangitis, Cholangitis, Sclerosing
Colitis Colitis

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412