TSLP (thymic stromal lymphopoietin)

Gene

• Entrez ID: 85480
• Gene name: Thymic stromal lymphopoietin
• Gene symbol: TSLP
• Synonyms: -
• Chromosome: 5
• Chromosome location: 5q22.1
• Summary: This gene encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attract

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017769	hsa-miR-335-5p	Microarray	18185580
MIRT527990	hsa-miR-652-5p	PAR-CLIP	22012620
MIRT527989	hsa-miR-6732-3p	PAR-CLIP	22012620
MIRT527988	hsa-miR-4323	PAR-CLIP	22012620
MIRT527987	hsa-miR-3943	PAR-CLIP	22012620
MIRT527986	hsa-miR-6769a-3p	PAR-CLIP	22012620
MIRT527985	hsa-miR-211-3p	PAR-CLIP	22012620
MIRT527984	hsa-miR-4270	PAR-CLIP	22012620
MIRT527983	hsa-miR-4441	PAR-CLIP	22012620
MIRT527982	hsa-miR-6754-5p	PAR-CLIP	22012620
MIRT527981	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT527980	hsa-miR-1266-5p	PAR-CLIP	22012620
MIRT527979	hsa-miR-4518	PAR-CLIP	22012620
MIRT527978	hsa-miR-5699-5p	PAR-CLIP	22012620
MIRT527977	hsa-miR-299-5p	PAR-CLIP	22012620
MIRT527990	hsa-miR-652-5p	PAR-CLIP	22012620
MIRT527989	hsa-miR-6732-3p	PAR-CLIP	22012620
MIRT527988	hsa-miR-4323	PAR-CLIP	22012620
MIRT527987	hsa-miR-3943	PAR-CLIP	22012620
MIRT527986	hsa-miR-6769a-3p	PAR-CLIP	22012620
MIRT527985	hsa-miR-211-3p	PAR-CLIP	22012620
MIRT527984	hsa-miR-4270	PAR-CLIP	22012620
MIRT527983	hsa-miR-4441	PAR-CLIP	22012620
MIRT527982	hsa-miR-6754-5p	PAR-CLIP	22012620
MIRT527981	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT527980	hsa-miR-1266-5p	PAR-CLIP	22012620
MIRT527979	hsa-miR-4518	PAR-CLIP	22012620
MIRT527978	hsa-miR-5699-5p	PAR-CLIP	22012620
MIRT527977	hsa-miR-299-5p	PAR-CLIP	22012620
MIRT2358610	hsa-miR-128	CLIP-seq
MIRT2358611	hsa-miR-1305	CLIP-seq
MIRT2358612	hsa-miR-27a	CLIP-seq
MIRT2358613	hsa-miR-27b	CLIP-seq
MIRT2358614	hsa-miR-302a	CLIP-seq
MIRT2358615	hsa-miR-302b	CLIP-seq
MIRT2358616	hsa-miR-302c	CLIP-seq
MIRT2358617	hsa-miR-302d	CLIP-seq
MIRT2358618	hsa-miR-302e	CLIP-seq
MIRT2358619	hsa-miR-3692	CLIP-seq
MIRT2358620	hsa-miR-372	CLIP-seq
MIRT2358621	hsa-miR-373	CLIP-seq
MIRT2358622	hsa-miR-4255	CLIP-seq
MIRT2358623	hsa-miR-4659a-3p	CLIP-seq
MIRT2358624	hsa-miR-4659b-3p	CLIP-seq
MIRT2358625	hsa-miR-4719	CLIP-seq
MIRT2358626	hsa-miR-4778-3p	CLIP-seq
MIRT2358627	hsa-miR-513b	CLIP-seq
MIRT2358628	hsa-miR-519a	CLIP-seq
MIRT2358629	hsa-miR-519b-3p	CLIP-seq
MIRT2358630	hsa-miR-519c-3p	CLIP-seq
MIRT2358631	hsa-miR-520a-3p	CLIP-seq
MIRT2358632	hsa-miR-520b	CLIP-seq
MIRT2358633	hsa-miR-520c-3p	CLIP-seq
MIRT2358634	hsa-miR-520d-3p	CLIP-seq
MIRT2358635	hsa-miR-520e	CLIP-seq
MIRT2358636	hsa-miR-548t	CLIP-seq
MIRT2358637	hsa-miR-607	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Unknown	22270071
RELA	Unknown	22270071

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001961	Process	Positive regulation of cytokine-mediated signaling pathway	IDA	11418668
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005125	Function	Cytokine activity	IDA	11418668
GO:0005125	Function	Cytokine activity	IMP	17242164
GO:0005139	Function	Interleukin-7 receptor binding	IMP	11480573
GO:0005576	Component	Extracellular region	IDA	11418668, 17242164
GO:0005576	Component	Extracellular region	IMP	11480573
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	11418668
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	11480573
GO:0032722	Process	Positive regulation of chemokine production	IDA	11418668
GO:0032733	Process	Positive regulation of interleukin-10 production	IMP	17242164
GO:0032736	Process	Positive regulation of interleukin-13 production	IMP	17242164
GO:0032754	Process	Positive regulation of interleukin-5 production	IMP	17242164
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	17242164
GO:0033005	Process	Positive regulation of mast cell activation	IMP	17242164
GO:0038111	Process	Interleukin-7-mediated signaling pathway	TAS
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	11480573
GO:0043066	Process	Negative regulation of apoptotic process	IDA	11480573
GO:0050729	Process	Positive regulation of inflammatory response	IMP	17242164
GO:0071654	Process	Positive regulation of chemokine (C-C motif) ligand 1 production	IMP	17242164
GO:0071657	Process	Positive regulation of granulocyte colony-stimulating factor production	IMP	17242164
GO:1904894	Process	Positive regulation of receptor signaling pathway via STAT	IDA	11418668

Other IDs

• MIM: 607003
• HGNC: 30743
• e!Ensembl: ENSG00000145777

Protein

• UniProt ID: Q969D9
• Protein name: Thymic stromal lymphopoietin
• Protein function: [Isoform 1]: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c(+) dendritic cells. Can induce allergic inflammation by directly activating mast cells. {ECO:00002
• PDB: 5J11, 5J12, 5J13, 8QFZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15216	TSLP	29 → 153	Thymic stromal lymphopoietin	Domain

• Sequence:

  MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKS
  TEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINA
  TQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

• Sequence length: 159

Pathways

KEGG:

Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway

Reactome:

Interleukin-7 signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Asthma	Asthma	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	30929738, 21804549
Dermatitis	Dermatitis, Atopic	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	16880407, 23688403, 22355542
Glomerulonephritis	Glomerulonephritis, Membranoproliferative	rs778043831	17686814
Nephrotic syndrome	Membranoproliferative Glomerulonephritis, Type I, Membranoproliferative Glomerulonephritis, Type II, Membranoproliferative Glomerulonephritis, Type III	rs876657369, rs121912601, rs121912602, rs876657370, rs121912603, rs121912604, rs121912605, rs121907900, rs121907901, rs28941778, rs587776576, rs28942089, rs587776577, rs28941777, rs121907910, rs1568296260, rs119473033, rs74315342, rs74315343, rs74315345, rs74315346, rs74315347, rs74315348, rs121434394, rs267606919, rs121912488, rs267606953, rs267606954, rs267606955, rs104886210, rs1591732280, rs1591750243, rs140511594, rs140781106, rs147972030, rs587776969, rs386833863, rs386833880, rs386833882, rs386833892, rs386833895, rs386833909, rs386833911, rs386833920, rs386833935, rs386833947, rs1555763603, rs398122978, rs398122979, rs398122980, rs369573693, rs398122981, rs398122982, rs398122983, rs200482683, rs730882194, rs180177201, rs587777552, rs587777553, rs775170915, rs749740335, rs12568913, rs530318579, rs786204583, rs786204708, rs786204632, rs138656762, rs797044992, rs797044994, rs797044995, rs864321632, rs864321687, rs864321688, rs864321633, rs869025495, rs869025541, rs869312747, rs145473779, rs757674160, rs869320695, rs138909849, rs869312984, rs1057516900, rs763818901, rs199506378, rs1057517164, rs1057516523, rs1057516414, rs778055996, rs1057516395, rs1057516747, rs1057516880, rs1057516680, rs778217926, rs1057519347, rs764587648, rs1060499703, rs121907903, rs769259446, rs1131692252, rs1131692253, rs1131692254, rs1131692255, rs1131692256, rs746887949, rs1131692235, rs1135402911, rs1135402912, rs1135402913, rs1554946480, rs1555331969, rs773173317, rs1555816634, rs775006954, rs1320543506, rs534522842, rs1272948499, rs1191455921, rs1291398331, rs1554939785, rs776016942, rs1031744496, rs748812981, rs755972674, rs1553312833, rs967339926, rs1462028977, rs1212702104, rs1167223941, rs762631237, rs1553316575, rs1553315173, rs1553316648, rs1553316611, rs780761368, rs368572297, rs1568070817, rs1321552081, rs1558108130, rs1558091788, rs1565707103, rs1558355124, rs1564622701, rs1351580598, rs1589475328, rs1589413498, rs1572255744, rs1572262824, rs761410195, rs1602413491, rs1590326226, rs375998390, rs570583897, rs369363545, rs201488687, rs1334894971, rs763782471, rs138047529, rs895782232, rs1572255047, rs1589433172, rs1589509476, rs1572277600, rs1572282458, rs1584675898, rs759043857, rs1853443391	17686814

Unknown
Disease name	Disease term	dbSNP ID	References
Eczema	Eczema, Infantile		23688403, 22355542, 16880407
Eosinophilia	Eosinophilic esophagitis		25017104, 20208534
Liver carcinoma	Liver carcinoma		28284560