Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
85416 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Zic family zinc finger 5 |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
ZIC5 |
SynonymsGene synonyms aliases
|
- |
ChromosomeChromosome number
|
13 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
13q32.3 |
SummarySummary of gene provided in NCBI Entrez Gene.
|
This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. The encoded protein may act as a transcriptional repressor. Studies in mouse and Xenopus support a role for this gene in neural crest development. Elevated expression of this |
miRNAmiRNA information provided by mirtarbase database.
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q96T25 |
Protein name |
Zinc finger protein ZIC 5 (Zinc finger protein of the cerebellum 5) |
Protein function |
Essential for neural crest development, converting cells from an epidermal fate to a neural crest cell fate. Binds to DNA (By similarity). |
Family and domains |
Pfam
Accession |
ID |
Position in sequence |
Description |
Type |
PF18366 |
zf_ZIC |
422 → 453 |
Zic proteins zinc finger domain |
Domain |
PF00096 |
zf-C2H2 |
491 → 515 |
Zinc finger, C2H2 type |
Domain |
PF00096 |
zf-C2H2 |
551 → 575 |
Zinc finger, C2H2 type |
Domain |
|
Sequence |
MFLKAGRGNKVPPVRVYGPDCVVLMEPPLSKRNPPALRLADLATAQVQPLQNMTGFPALA GPPAHSQLRAAVAHLRLRDLGADPGVATTPLGPEHMAQASTLGLSPPSQAFPAHPEAPAA AARAAALVAHPGAGSYPCGGGSSGAQPSAPPPPAPPLPPTPSPPPPPPPPPPPALSGYTT TNSGGGGSSGKGHSRDFVLRRDLSATAPAAAMHGAPLGGEQRSGTGSPQHPAPPPHSAGM FISASGTYAGPDGSGGPALFPALHDTPGAPGGHPHPLNGQMRLGLAAAAAAAAAELYGRA EPPFAPRSGDAHYGAVAAAAAAALHGYGAVNLNLNLAAAAAAAAAGPGPHLQHHAPPPAP PPPPAPAQHPHQHHPHLPGAAGAFLRYMRQPIKQELICKWIDPDELAGLPPPPPPPPPPP PPPPAGGAKPCSKTFGTMHELVNHVTVEHVGGPEQSSHVCFWEDCPREGKPFKAKYKLIN HIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKK HSHVHTSDKPYYCKIRGCDKSYTHPSSLRKHMKIHCKSPPPSPGPLGYSSVGTPVGAPLS PVLDPARSHSSTLSPQVTNLNEWYVCQASGAPSHLHTPSSNGTTSETEDEEIYGNPEVVR TIH
|
|
Sequence length |
663 |
Interactions |
View interactions |
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Anencephaly |
Iniencephaly, Exencephaly |
rs773607884 |
15136147 |
Neural tube defect |
Neural Tube Defects |
rs121918220, rs121434297, rs137853061, rs137853062, rs3127334, rs267607167, rs267607168, rs387907204, rs139365610, rs137955120, rs786201015, rs786201016, rs768434408, rs777661576, rs747846362, rs200137991, rs780014899, rs574132670, rs786204013, rs147257424, rs763539350, rs776483190, rs757259023, rs781461462, rs762921297, rs1114167354, rs557643577, rs147277149, rs765586205, rs377443637, rs1563593163, rs1303000329, rs1565818580, rs986604359, rs1293600145, rs114727354, rs146357218, rs768980918, rs140277700, rs139645527, rs750323424, rs368321176, rs1579619636, rs893229476, rs754990692, rs763079713, rs1593037878, rs747100389, rs372056091, rs1593083585, rs778121031, rs748778907, rs776969786, rs1189298981, rs375908206, rs1734858651, rs778738842 |
15136147 |
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Acrania |
Acrania |
|
15136147 |
Craniorachischisis |
Craniorachischisis |
|
15136147 |
Diastematomyelia |
Diastematomyelia |
|
15136147 |
Liver carcinoma |
Liver carcinoma |
|
28284560 |
Neurenteric cyst |
Neurenteric Cyst |
|
15136147 |
Primary tethered cord syndrome |
Tethered Cord Syndrome |
|
15136147 |
Spinal cord myelodysplasia |
Spinal Cord Myelodysplasia |
|
15136147 |
|