TRIM5 (tripartite motif containing 5)

Gene

• Entrez ID: 85363
• Gene name: Tripartite motif containing 5
• Gene symbol: TRIM5
• Synonyms: RNF88, TRIM5alpha
• Chromosome: 11
• Chromosome location: 11p15.4
• Summary: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein forms homo-oligomers via the coilel-coil region and localizes to cytoplasmic bodies. It appears to function as a E3 ubiquitin-ligase and ubiqutinates itself to regulate its subcellular localization. It may play a role in retroviral restriction. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Dec 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT052397	hsa-let-7a-5p	CLASH	23622248
MIRT439390	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT449403	hsa-miR-599	PAR-CLIP	22100165
MIRT449404	hsa-miR-3161	PAR-CLIP	22100165
MIRT449405	hsa-miR-8070	PAR-CLIP	22100165
MIRT449406	hsa-miR-3689f	PAR-CLIP	22100165
MIRT449407	hsa-miR-3689e	PAR-CLIP	22100165
MIRT449408	hsa-miR-3689b-5p	PAR-CLIP	22100165
MIRT449409	hsa-miR-3689a-5p	PAR-CLIP	22100165
MIRT449410	hsa-miR-190b	PAR-CLIP	22100165
MIRT449411	hsa-miR-190a-5p	PAR-CLIP	22100165
MIRT449412	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT449413	hsa-miR-4712-3p	PAR-CLIP	22100165
MIRT449414	hsa-miR-7161-5p	PAR-CLIP	22100165
MIRT449415	hsa-miR-8087	PAR-CLIP	22100165
MIRT449416	hsa-miR-548u	PAR-CLIP	22100165

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IBA	21873635
GO:0000932	Component	P-body	IDA	20357094
GO:0002218	Process	Activation of innate immune response	IDA	21512573
GO:0003713	Function	Transcription coactivator activity	IDA	23077300
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	21512573
GO:0005515	Function	Protein binding	IPI	20357094, 21512573, 22078707, 22493164, 25127057, 25203322
GO:0005654	Component	Nucleoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	18248090, 25127057
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006914	Process	Autophagy	IDA	25127057
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA	21873635
GO:0010508	Process	Positive regulation of autophagy	IBA	21873635
GO:0016032	Process	Viral process	IEA
GO:0016567	Process	Protein ubiquitination	IBA	21873635
GO:0019901	Function	Protein kinase binding	IBA	21873635
GO:0019901	Function	Protein kinase binding	IPI	25127057
GO:0030674	Function	Protein-macromolecule adaptor activity	IPI	25127057
GO:0031664	Process	Regulation of lipopolysaccharide-mediated signaling pathway	IMP	21512573
GO:0032880	Process	Regulation of protein localization	IBA	21873635
GO:0032880	Process	Regulation of protein localization	IMP	25127057
GO:0038187	Function	Pattern recognition receptor activity	IDA	21512573
GO:0042802	Function	Identical protein binding	IPI	22493164, 22829933
GO:0042803	Function	Protein homodimerization activity	IBA	21873635
GO:0042803	Function	Protein homodimerization activity	IPI	11331580
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	21873635
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	23077300
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	21512573
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	21512573
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045087	Process	Innate immune response	IDA	18248090
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IEA
GO:0046596	Process	Regulation of viral entry into host cell	IBA	21873635
GO:0046597	Process	Negative regulation of viral entry into host cell	IDA	18248090
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	23077300
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IBA	21873635
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	21512573, 23077300
GO:0051607	Process	Defense response to virus	TAS	21512573, 22291694
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:0061630	Function	Ubiquitin protein ligase activity	IBA	21873635
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	21512573
GO:1902187	Process	Negative regulation of viral release from host cell	IDA	18248090
GO:1990462	Component	Omegasome	IDA	25127057

Other IDs

• MIM: 608487
• HGNC: 16276
• e!Ensembl: ENSG00000132256

Protein

• UniProt ID: Q9C035
• Protein name: Tripartite motif-containing protein 5 (EC 2.3.2.27) (RING finger protein 88) (RING-type E3 ubiquitin transferase TRIM5)
• Protein function: Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Restricts infection by N-tropic murine leukemia virus (N-MLV), equine infectious anemia virus (EIAV), simian immunodeficiency virus of macaques (SIVmac), feline immunodeficiency virus (FIV), and bovine immunodeficiency virus (BIV) (PubMed:17156811). Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2 (PubMed:25127057). Also plays a role in autophagy by acting as a selective autophagy receptor which recognizes and targets HIV-1 capsid protein p24 for autophagic destruction (PubMed:25127057).
• PDB: 2ECV, 2YRG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13445	zf-RING_UBOX	15 → 56	RING-type zinc-finger	Domain
  PF00643	zf-B_box	90 → 131	B-box zinc finger	Domain
  PF00622	SPRY	358 → 489	SPRY domain	Family

• Sequence:

  MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRI
  SYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERS
  QEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTN
  VLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQTQSLRELISDLEHRLQ
  GSVMELLQGVDGVIKRTENVTLKKPETFPKNQRRVFRAPDLKGMLEVFRELTDVRRYWVD
  VTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGSQSITSGKHY
  WEVDVSKKTAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDSSFHT
  PSVPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPR
  KCGVPMTLCSPSS

• Sequence length: 493

Pathways

KEGG:

Viral life cycle - HIV-1
Human immunodeficiency virus 1 infection

Reactome:

Interferon gamma signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs-1, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	29212778

Unknown
Disease name	Disease term	dbSNP ID	References
Malignant neoplasm of anterior portion of floor of mouth	Malignant neoplasm of anterior portion of floor of mouth		27749845
Malignant neoplasm of lip and oral cavity	Malignant neoplasm of other sites within the lip and oral cavity		27749845
Malignant neoplasm of mouth	Malignant neoplasm of other specified parts of mouth, Malignant neoplasm of mouth		27749845
Malignant tumor of lateral floor of mouth	Malignant neoplasm of lateral floor of mouth		27749845
Malignant neoplasm of floor of mouth	Malignant neoplasm of floor of mouth		27749845
Pharyngeal neoplasms	Pharyngeal Neoplasms		27749845
Vascular diseases	Peripheral Arterial Diseases		27082954