GediPNet logo

SYDE1 (synapse defective Rho GTPase activating protein 1)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
85360
Gene nameGene Name - the full gene name approved by the HGNC.
Synapse defective Rho GTPase activating protein 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
SYDE1
SynonymsGene synonyms aliases
7h3, SYD1
ChromosomeChromosome number
19
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.12
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a Rho GTPase-activating protein highly expressed in placenta. The encoded protein is involved in cytoskeletal remodeling and trophoblast cell migration. Decreased expression of this gene has been associated with intraut
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1405129 hsa-miR-1178 CLIP-seq
MIRT1405130 hsa-miR-128 CLIP-seq
MIRT1405131 hsa-miR-1321 CLIP-seq
MIRT1405132 hsa-miR-148a CLIP-seq
MIRT1405133 hsa-miR-148b CLIP-seq
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005096 Function GTPase activator activity IDA 27917469
GO:0005096 Function GTPase activator activity IMP 27917469
GO:0005096 Function GTPase activator activity ISS
GO:0005829 Component Cytosol TAS
GO:0007165 Process Signal transduction IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q6ZW31
Protein name Rho GTPase-activating protein SYDE1 (Synapse defective protein 1 homolog 1) (Protein syd-1 homolog 1)
Protein function GTPase activator for the Rho-type GTPases. As a GCM1 downstream effector, it is involved in placental development and positively regulates trophoblast cells migration. It regulates cytoskeletal remodeling by controlling the activity of Rho GTPas
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00620 RhoGAP
414 570
RhoGAP domain
Domain
Sequence
MAEPLLRKTFSRLRGREKLPRKKSDAKERGHPAQRPEPSPPEPEPQAPEGSQAGAEGPSS
PEASRSPARGAYLQSLEPSSRRWVLGGAKPAEDTSLGPGVPGTGEPAGEIWYNPIPEEDP
RPPAPEPPGPQPGSAESEGLAPQGAAPASPPTKASRTKSPGPARRLSIKMKKLPELRRRL
SLRGPRAGRERERAAPAGSVISRYHLDSSVGGPGPAAGPGGTRSPRAGYLSDGDSPERPA
GPPSPTSFRPYEVGPAARAPPAALWGRLSLHLYGLGGLRPAPGATPRDLCCLLQVDGEAR
ARTGPLRGGPDFLRLDHTFHLELEAARLLRALVLAWDPGVRRHRPCAQGTVLLPTVFRGC
QAQQLAVRLEPQGLLYAKLTLSEQQEAPATAEPRVFGLPLPLLVERERPPGQVPLIIQKC
VGQIERRGLRVVGLYRLCGSAAVKKELRDAFERDSAAVCLSEDLYPDINVITGILKDYLR
ELPTPLITQPLYKVVLEAMARDPPNRVPPTTEGTRGLLSCLPDVERATLTLLLDHLRLVS
SFHAYNRMTPQNLAVCFGPVLLPARQAPTR
PRARSSGPGLASAVDFKHHIEVLHYLLQSW
PDPRLPRQSPDVAPYLRPKRQPPLHLPLADPEVVTRPRGRGGPESPPSNRYAGDWSVCGR
DFLPCGRDFLSGPDYDHVTGSDSEDEDEEVGEPRVTGDFEDDFDAPFNPHLNLKDFDALI
LDLERELSKQINVCL
Sequence length 735
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
Reactome
    Rho GTPase cycle
Associated diseases
Unknown
Disease name Disease term dbSNP ID References
Pancreatic adenocarcinoma Pancreatic Ductal Adenocarcinoma rs121908291, rs139375029, rs587780197, rs587780198, rs587780200, rs374741161, rs368806050, rs113676921, rs587780753, rs550499593, rs143544548, rs587780754, rs587780755, rs587780756, rs114593924, rs587780757, rs587780758, rs532961259, rs587780759, rs535155432, rs543821321, rs587780760, rs587780761, rs368350042, rs368890611, rs200060953, rs559000839, rs587780762, rs142116575, rs150764613, rs62333013, rs59633770, rs370602081, rs759105985, rs535118290, rs528879194, rs863224705, rs758706279, rs780516159, rs863224383, rs863224384, rs777359545, rs863224385, rs570874237, rs863224386, rs753092219, rs769161509, rs143417961, rs140360991, rs201707558, rs863224702, rs754158038, rs863224382, rs761530979, rs780692056, rs863224703, rs114250766, rs113515140, rs863224704, rs561750970, rs864622627, rs864622590, rs864622422, rs864622140, rs730882137, rs864622087, rs864622226, rs864622591, rs864622321, rs864622158, rs864622531, rs767729090, rs749041581, rs768485147, rs864622234, rs864622355, rs864622316, rs864622388, rs764242515, rs778134231, rs771679229, rs746599370, rs551131343, rs878854264, rs878854265, rs878854266, rs878854267, rs878854268, rs376654786, rs373500403, rs114171764, rs376394488, rs61051061, rs1806729, rs548068667, rs781516286, rs1059444, rs750112132, rs7673220, rs1060502975, rs778471055, rs925242863, rs143717202, rs372414187, rs927644209, rs764265611, rs1060502976, rs554297134, rs997146277, rs1060502974, rs1060504775, rs200020758, rs1060502973, rs777453756, rs952110792, rs1553965295, rs1553973196, rs1177108180, rs1477864263, rs368472947, rs182571219, rs1553984987, rs1263751006, rs201979617, rs1358006173, rs151071844, rs115937217, rs568490721, rs189021816, rs1319983866, rs1553965480, rs1553969553, rs1385898569, rs1553965526, rs1553968628, rs763802548, rs752296365, rs1553965214, rs1474793366, rs1553965326, rs778313832, rs1318598425, rs1470434769, rs755223646, rs557697540, rs747702421, rs1560940853, rs1560839872, rs1216822754, rs751364707, rs372708613, rs1560929667, rs1306250811, rs774034818, rs551420048, rs1581871066, rs1221751077, rs1220928329, rs759161069, rs757164572, rs115274645, rs769973229, rs115988233, rs767384375, rs778210310, rs1305250587, rs1239099971, rs1025237623, rs1211489449, rs900642927, rs1400689367, rs140584890, rs757885388, rs1231114395, rs996343137, rs1275232115, rs1046350904, rs762267147, rs373066707, rs867266337, rs1460784357, rs748432333, rs769517051, rs1560937938, rs750033888, rs781065277, rs1751999027, rs1246689760, rs1752077261, rs1754079127, rs1754736103, rs1757056910, rs114673468, rs756934356, rs1176026649, rs1762161869, rs200399043, rs1447433925, rs1389221540, rs893660432, rs1762582426

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412