ADTRP (androgen dependent TFPI regulating protein)

Gene

• Entrez ID: 84830
• Gene name: Androgen dependent TFPI regulating protein
• Gene symbol: ADTRP
• Synonyms: AIG1L, C6orf105, dJ413H6.1
• Chromosome: 6
• Chromosome location: 6p24.1

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	28341552
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IMP	28341552
GO:0002686	Process	Negative regulation of leukocyte migration	IMP	28341552
GO:0003332	Process	Negative regulation of extracellular matrix constituent secretion	IMP	28341552
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005901	Component	Caveola	IDA	21868574
GO:0009986	Component	Cell surface	IDA	21868574
GO:0010628	Process	Positive regulation of gene expression	IMP	21868574, 28341552
GO:0016020	Component	Membrane	IDA	27018888
GO:0016021	Component	Integral component of membrane	IEA
GO:0016787	Function	Hydrolase activity	IMP	27018888
GO:0030195	Process	Negative regulation of blood coagulation	IMP	21868574
GO:0042758	Process	Long-chain fatty acid catabolic process	IMP	27018888
GO:0043491	Process	Protein kinase B signaling	IMP	28341552
GO:0050709	Process	Negative regulation of protein secretion	IMP	28341552
GO:0071383	Process	Cellular response to steroid hormone stimulus	IEP	21868574
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IMP	28341552
GO:1903038	Process	Negative regulation of leukocyte cell-cell adhesion	IMP	28341552
GO:2000402	Process	Negative regulation of lymphocyte migration	IMP	28341552

Other IDs

• MIM: 614348
• HGNC: 21214
• e!Ensembl: ENSG00000111863

Protein

• UniProt ID: Q96IZ2
• Protein name: Androgen-dependent TFPI-regulating protein (Fatty acid esters of hydroxy fatty acids hydrolase ADTRP) (FAHFA hydrolase ADTRP) (EC 3.1.-.-)
• Protein function: Hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), but not other major classes of lipids (PubMed:27018888). Show a preference for FAHFAs with branching distal from the carboxylate head group of the lipids (PubMed:27018888). Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro) (PubMed:21868574).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04750	Far-17a_AIG1	5 → 216	FAR-17a/AIG1-like protein	Family

• Sequence:

  MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGV
  TCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDT
  VIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTW
  VYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK

• Sequence length: 230

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs-1, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	21378986
Coronary heart disease	Coronary heart disease	rs-1	21378986

Unknown
Disease name	Disease term	dbSNP ID	References
Coronary arteriosclerosis	Coronary Arteriosclerosis		21378986
Development disorder	Child Development Disorders, Pervasive		30804558