GediPNet logo

DPY30 (dpy-30 histone methyltransferase complex regulatory subunit)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84661
Gene nameGene Name - the full gene name approved by the HGNC.
Dpy-30 histone methyltransferase complex regulatory subunit
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
DPY30
SynonymsGene synonyms aliases
Cps25, HDPY-30, Saf19
ChromosomeChromosome number
2
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p22.3
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes an integral core subunit of the SET1/MLL family of H3K4 methyltransferases. The encoded protein directly controls cell cycle regulators and plays an important role in the proliferation and differentiation of human hematopoietic progenito
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023776 hsa-miR-1-3p Proteomics 18668040
MIRT944887 hsa-miR-101 CLIP-seq
MIRT944888 hsa-miR-1267 CLIP-seq
MIRT944889 hsa-miR-139-5p CLIP-seq
MIRT944890 hsa-miR-144 CLIP-seq
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000781 Component Chromosome, telomeric region IEA
GO:0005515 Function Protein binding IPI 16189514, 17500065, 19556245, 21516116, 23414517, 23995757, 24722188, 24981860, 25416956, 25456412, 31485071, 31515488, 32296183
GO:0005634 Component Nucleus IDA 17500065, 19651892
GO:0005654 Component Nucleoplasm IDA
GO:0005654 Component Nucleoplasm TAS
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q9C005
Protein name Protein dpy-30 homolog (Dpy-30-like protein) (Dpy-30L)
Protein function As part of the MLL1/MLL complex, involved in the methylation of histone H3 at 'Lys-4', particularly trimethylation. Histone H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. May play some role in histone
PDB 3G36 , 4RIQ , 4RT4 , 4RTA , 6E2H , 6PWV , 7UD5
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05186 Dpy-30
52 93
Dpy-30 motif
Motif
Sequence
MEPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQT
VVPILLQGLAVLAKERPPNPIEFLASYLLKNKA
QFEDRN
Sequence length 99
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
Reactome
    PKMTs methylate histone lysines
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
Associated diseases
Unknown
Disease name Disease term dbSNP ID References
Alopecia Alopecia 28196072
Alopecia, male pattern Alopecia, Male Pattern 29146897
Androgenetic alopecia Androgenetic Alopecia, Alopecia, Androgenetic, 3, Alopecia, Androgenetic, 2, Alopecia, Androgenetic, 1 29146897

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412