GediPNet logo

KLF11 (KLF transcription factor 11)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8462
Gene nameGene Name - the full gene name approved by the HGNC.
KLF transcription factor 11
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
KLF11
SynonymsGene synonyms aliases
FKLF, FKLF1, MODY7, TIEG2, Tieg3
ChromosomeChromosome number
2
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p25.1
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a zinc finger transcription factor that binds to SP1-like sequences in epsilon- and gamma-globin gene promoters. This binding inhibits cell growth and causes apoptosis. Defects in this gene are a cause of maturity-onset
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs34336420 C>G,T Likely-benign, pathogenic, benign Coding sequence variant, missense variant
rs121912645 G>T Pathogenic Coding sequence variant, missense variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016644 hsa-miR-429 Reporter assay 20005803
MIRT020284 hsa-miR-130b-3p Sequencing 20371350
MIRT020356 hsa-miR-200a-3p Reporter assay 20005803
MIRT021077 hsa-miR-200c-3p Reporter assay 20005803
MIRT021660 hsa-miR-141-3p Reporter assay 20005803
Transcription factors
Transcription factor Regulation Reference
NR1H4 Unknown 20060466
STAT3 Activation 18505768
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000083 Process Regulation of transcription involved in G1/S transition of mitotic cell cycle IDA 21171965
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 21171965
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding IDA 21171965
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID O14901
Protein name Krueppel-like factor 11 (Transforming growth factor-beta-inducible early growth response protein 2) (TGFB-inducible early growth response protein 2) (TIEG-2)
Protein function Transcription factor (PubMed:10207080, PubMed:9748269). Activates the epsilon- and gamma-globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding inhibiting cell growth (PubMed:1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2
394 418
Zinc finger, C2H2 type
Domain
PF00096 zf-C2H2
424 448
Zinc finger, C2H2 type
Domain
PF00096 zf-C2H2
454 476
Zinc finger, C2H2 type
Domain
Sequence
MHTPDFAGPDDARAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQR
SQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQSPDLVEPSTR
TPVSPQVTDSKACTATDVLQSSAVVARALSGGAERGLLGLEPVPSSPCRAKGTSVIRHTG
ESPAACFPTIQTPDCRLSDSREGEEQLLGHFETLQDTHLTDSLLSTNLVSCQPCLHKSGG
LLLTDKGQQAGWPGAVQTCSPKNYENDLPRKTTPLISVSVPAPPVLCQMIPVTGQSSMLP
AFLKPPPQLSVGTVRPILAQAAPAPQPVFVGPAVPQGAVMLVLPQGALPPPAPCAANVMA
AGNTKLLPLAPAPVFITSSQNCVPQVDFSRRRNYVCSFPGCRKTYFKSSHLKAHLRTHTG
EKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTK
KIPGWQAEVGKLNRIASAESPGSPLVSMPASA
Sequence length 512
Interactions View interactions
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Hyperinsulinemic hypoglycemia Congenital Hyperinsulinism, Hyperinsulinemic hypoglycemia rs137853103, rs2126234459, rs104894237, rs267607196, rs387906407, rs151344623, rs28936370, rs28938469, rs28936371, rs137852671, rs137852672, rs72559723, rs193922400, rs137852676, rs193922402, rs980458021, rs375717077, rs786200932, rs587783169, rs72559713, rs72559716, rs786204542, rs541269678, rs570388861, rs72559722, rs786204676, rs151344624, rs797045637, rs797045212, rs797045211, rs797045207, rs797045213, rs761749884, rs863225280, rs139964066, rs886039877, rs886041392, rs886041391, rs746480424, rs1057516281, rs1057516317, rs576684889, rs764613146, rs773306994, rs1057516946, rs1057517139, rs1057516591, rs201682634, rs766891274, rs193922405, rs72559715, rs769518471, rs757171524, rs139328569, rs768951263, rs72559718, rs1260178539, rs200670692, rs72559734, rs1554910610, rs1554924035, rs372307320, rs1446306735, rs925231098, rs1554913069, rs1554923999, rs765090096, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1554949176, rs1411638309, rs1008906426, rs758844607, rs1554924540, rs755259997, rs769569410, rs72559730, rs367850779, rs1382448285, rs1564977373, rs750586210, rs1398546361, rs781617345
Diabetes mellitus Diabetes Mellitus, Non-Insulin-Dependent, Transient neonatal diabetes mellitus rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs1553638903, rs1553638909, rs948820149, rs371977235, rs1553784995, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261
Kidney disease Kidney Diseases rs74315342, rs749740335, rs757649673, rs112417755, rs35138315
Mason type diabetes MATURITY-ONSET DIABETES OF THE YOUNG, TYPE 7 (disorder), Maturity onset diabetes mellitus in young, MODY rs80356625, rs104894237, rs587776825, rs137853236, rs137853237, rs137853238, rs1566092470, rs1463923467, rs137853243, rs137853244, rs104894006, rs80356655, rs104894008, rs193922254, rs193922259, rs193922263, rs193922264, rs193922265, rs193922268, rs193922269, rs193922272, rs193922275, rs193922280, rs193922281, rs193922284, rs193922289, rs193922291, rs193922295, rs193922300, rs193922302, rs193922313, rs193922314, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922329, rs193922330, rs193922331, rs193922336, rs193922340, rs193922475, rs193922476, rs193922479, rs193922480, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs587780344, rs587780346, rs587780357, rs587783672, rs786204676, rs151344624, rs794727775, rs794727839, rs759072800, rs797045595, rs863225280, rs864321656, rs878853246, rs886039544, rs886039386, rs886042015, rs886041690, rs886041391, rs886041820, rs886042610, rs754728827, rs1057517745, rs1057521094, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524898, rs1057524904, rs1057524905, rs764232985, rs1057524908, rs1064793134, rs1064796410, rs1057520109, rs769086289, rs1085307455, rs1085307913, rs1131691483, rs765432081, rs1131692182, rs1554335441, rs762263694, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555833071, rs1554334539, rs1554334610, rs1554334613, rs193922258, rs1554334894, rs1554334905, rs1554335111, rs1554335132, rs1554335135, rs1332966015, rs746913146, rs1246464603, rs1554335573, rs1554335585, rs1554335966, rs1260178539, rs1555260207, rs1555210478, rs1555211426, rs1555211436, rs1555211922, rs1555211999, rs1555212014, rs1555816615, rs1555816642, rs1555817851, rs144723656, rs1555211904, rs1555211975, rs779184183, rs1555815158, rs1554335564, rs1555212396, rs1555815396, rs1400535021, rs1555813342, rs1555815393, rs1554334872, rs1555212749, rs1555833144, rs1555212363, rs1555813267, rs1236613475, rs1554924035, rs1554913069, rs1554933565, rs766431403, rs758844607, rs771108132, rs1566092307, rs753998395, rs1565885935, rs1562711915, rs1562713041, rs1562715296, rs1562715657, rs1562717053, rs1562718043, rs1564869850, rs193922401, rs755259997, rs1565883507, rs1172328722, rs1286294151, rs1565886545, rs1565887211, rs1375557127, rs1568731279, rs1562719029, rs1562715426, rs776793516, rs1568724014, rs1392795567, rs1562719705, rs1564977373, rs1598806177, rs1598809747, rs1598815016, rs1598840773, rs1598840795, rs1598841082, rs1598842886, rs1598848672, rs1598854261, rs1598854747, rs1229650809, rs1598840996, rs1583592247, rs780612692, rs1593060859, rs1583590393, rs1583591700, rs1583591809, rs1583596522, rs751279776, rs1583601365, rs1281712444, rs1593060890, rs1593060912, rs1592898255, rs1290868034, rs1191912908, rs1583601110, rs1593054210, rs1592897526, rs1600707958, rs1600710669, rs1598809697, rs1593058932, rs1593060966, rs2096270755, rs1364708195, rs1877324101 15774581, 21844708
Unknown
Disease name Disease term dbSNP ID References
Pancreatic hypoplasia Congenital hypoplasia of pancreas rs28509441, rs193922358, rs199644078, rs1380564366, rs143517122
Exocrine pancreatic insufficiency Exocrine pancreatic insufficiency
Hepatocellular adenoma Hepatocellular Adenoma
Hyperglycemia Hyperglycemia

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412