ZGPAT (zinc finger CCCH-type and G-patch domain containing)

Gene

• Entrez ID: 84619
• Gene name: Zinc finger CCCH-type and G-patch domain containing
• Gene symbol: ZGPAT
• Synonyms: GPATC6, GPATCH6, KIAA1847, ZC3H9, ZC3HDC9, ZIP
• Chromosome: 20
• Chromosome location: 20q13.33

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2374669	hsa-miR-1207-5p	CLIP-seq
MIRT2374670	hsa-miR-141	CLIP-seq
MIRT2374671	hsa-miR-200a	CLIP-seq
MIRT2374672	hsa-miR-214	CLIP-seq
MIRT2374673	hsa-miR-3120-5p	CLIP-seq
MIRT2374674	hsa-miR-3619-5p	CLIP-seq
MIRT2374675	hsa-miR-365	CLIP-seq
MIRT2374676	hsa-miR-3663-5p	CLIP-seq
MIRT2374677	hsa-miR-3665	CLIP-seq
MIRT2374678	hsa-miR-4291	CLIP-seq
MIRT2374679	hsa-miR-4480	CLIP-seq
MIRT2374680	hsa-miR-4519	CLIP-seq
MIRT2374681	hsa-miR-4660	CLIP-seq
MIRT2374682	hsa-miR-4667-3p	CLIP-seq
MIRT2374683	hsa-miR-4736	CLIP-seq
MIRT2374684	hsa-miR-4749-3p	CLIP-seq
MIRT2374685	hsa-miR-4763-3p	CLIP-seq
MIRT2374686	hsa-miR-502-5p	CLIP-seq
MIRT2374687	hsa-miR-512-5p	CLIP-seq
MIRT2374688	hsa-miR-541	CLIP-seq
MIRT2374689	hsa-miR-654-5p	CLIP-seq
MIRT2374690	hsa-miR-761	CLIP-seq
MIRT2374691	hsa-miR-922	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	19644445
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19644445
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	19644445
GO:0003700	Function	DNA-binding transcription factor activity	IDA	19644445
GO:0005515	Function	Protein binding	IPI	19644445, 21516116, 25416956, 31515488
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	19644445
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007175	Process	Negative regulation of epidermal growth factor-activated receptor activity	IDA	19644445
GO:0043565	Function	Sequence-specific DNA binding	IDA	19644445
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	19644445
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 619577
• HGNC: 15948
• e!Ensembl: ENSG00000197114

Protein

• UniProt ID: Q8N5A5
• Protein name: Zinc finger CCCH-type with G patch domain-containing protein (G patch domain-containing protein 6) (Zinc finger CCCH domain-containing protein 9) (Zinc finger and G patch domain-containing protein)
• Protein function: Transcription repressor that specifically binds the 5'-GGAG[GA]A[GA]A-3' consensus sequence. Represses transcription by recruiting the chromatin multiprotein complex NuRD to target promoters. Negatively regulates expression of EGFR, a gene invol
• PDB: 4II1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF18044	zf-CCCH_4	178 → 199	CCCH-type zinc finger	Domain
  PF01585	G-patch	333 → 376	G-patch domain	Family

• Sequence:

  MDEESLESALQTYRAQLQQVELALGAGLDSSEQADLRQLQGDLKELIELTEASLVSVRKS
  SLLAALDEERPGRQEDAEYQAFREAITEAVEAPAAARGSGSETVPKAEAGPESAAGGQEE
  EEGEDEEELSGTKVSAPYYSSWGTLEYHNAMVVGTEEAEDGSAGVRVLYLYPTHKSLKPC
  PFFLEGKCRFKENCRFSHGQVVSLDELRPFQDPDLSSLQAGSACLAKHQDGLWHAARITD
  VDNGYYTVKFDSLLLREAVVEGDGILPPLRTEATESDSDSDGTGDSSYARVVGSDAVDSA
  QSSALCPSLAVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRV
  EPIHAVVLPRGKSLDQCVETLQKQTRVGKAGTNKPPRCRGRGARPGGRPAPRNVFDFLNE
  KLQGQAPGALEAGAAPAGRRSKDMYHASKSAKRALSLRLFQTEEKIERTQRDIRSIQEAL
  ARNAGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF

• Sequence length: 531

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs139868987, rs750447828, rs368138379, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468	18758464, 23128233
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039, rs483353038, rs61731956, rs568165874, rs767480544	22190364
Prostate cancer	Malignant neoplasm of prostate, Prostate carcinoma	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	23535732, 23535732, 29892016

Unknown
Disease name	Disease term	dbSNP ID	References
Crohn disease	Crohn Disease	rs2066847, rs2066844, rs886052047, rs5743265, rs111608429, rs104895438	21102463, 26192919
Ulcerative colitis	Ulcerative Colitis		26192919