GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

NCK2 (NCK adaptor protein 2)

Gene

8440

NCK adaptor protein 2

NCK2

GRB4, NCKbeta

2q12.2

This gene encodes a member of the NCK family of adaptor proteins. The protein contains three SH3 domains and one SH2 domain. The protein has no known catalytic function but has been shown to bind and recruit various proteins involved in the regulation of

Show/Hide all(129)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021929	hsa-miR-128-3p	Microarray	17612493
MIRT036831	hsa-miR-877-3p	CLASH	23622248
MIRT297070	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT707144	hsa-miR-648	HITS-CLIP	21572407
MIRT297079	hsa-miR-5692b	HITS-CLIP	21572407
MIRT297077	hsa-miR-5692c	HITS-CLIP	21572407
MIRT297076	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707143	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT297064	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707142	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT202702	hsa-miR-505-3p	PAR-CLIP	23592263
MIRT492979	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT202701	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT202707	hsa-miR-5688	PAR-CLIP	23592263
MIRT202700	hsa-miR-337-5p	PAR-CLIP	23592263
MIRT492978	hsa-miR-5683	PAR-CLIP	23592263
MIRT202703	hsa-miR-3065-5p	PAR-CLIP	23592263
MIRT202705	hsa-miR-4742-3p	PAR-CLIP	23592263
MIRT399633	hsa-miR-548v	PAR-CLIP	23592263
MIRT492977	hsa-miR-496	PAR-CLIP	23592263
MIRT202708	hsa-miR-7159-5p	PAR-CLIP	23592263
MIRT492976	hsa-miR-452-3p	PAR-CLIP	23592263
MIRT202706	hsa-miR-3591-5p	PAR-CLIP	23592263
MIRT297070	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT707144	hsa-miR-648	HITS-CLIP	21572407
MIRT297079	hsa-miR-5692b	HITS-CLIP	21572407
MIRT297077	hsa-miR-5692c	HITS-CLIP	21572407
MIRT297076	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707143	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT297064	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707142	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT202702	hsa-miR-505-3p	PAR-CLIP	23592263
MIRT492979	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT202701	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT202707	hsa-miR-5688	PAR-CLIP	23592263
MIRT202700	hsa-miR-337-5p	PAR-CLIP	23592263
MIRT492978	hsa-miR-5683	PAR-CLIP	23592263
MIRT202703	hsa-miR-3065-5p	PAR-CLIP	23592263
MIRT202705	hsa-miR-4742-3p	PAR-CLIP	23592263
MIRT399633	hsa-miR-548v	PAR-CLIP	23592263
MIRT492977	hsa-miR-496	PAR-CLIP	23592263
MIRT202708	hsa-miR-7159-5p	PAR-CLIP	23592263
MIRT492976	hsa-miR-452-3p	PAR-CLIP	23592263
MIRT202706	hsa-miR-3591-5p	PAR-CLIP	23592263
MIRT1176380	hsa-miR-137	CLIP-seq
MIRT1176381	hsa-miR-145	CLIP-seq
MIRT1176382	hsa-miR-4712-5p	CLIP-seq
MIRT1176383	hsa-miR-4783-3p	CLIP-seq
MIRT1176384	hsa-miR-545	CLIP-seq
MIRT1176385	hsa-miR-770-5p	CLIP-seq
MIRT1176386	hsa-miR-876-3p	CLIP-seq
MIRT1176387	hsa-miR-1249	CLIP-seq
MIRT1176388	hsa-miR-200b	CLIP-seq
MIRT1176389	hsa-miR-200c	CLIP-seq
MIRT1176390	hsa-miR-219-1-3p	CLIP-seq
MIRT1176391	hsa-miR-2909	CLIP-seq
MIRT1176392	hsa-miR-3148	CLIP-seq
MIRT1176393	hsa-miR-3173-5p	CLIP-seq
MIRT1176394	hsa-miR-320a	CLIP-seq
MIRT1176395	hsa-miR-320b	CLIP-seq
MIRT1176396	hsa-miR-320c	CLIP-seq
MIRT1176397	hsa-miR-320d	CLIP-seq
MIRT1176398	hsa-miR-320e	CLIP-seq
MIRT1176399	hsa-miR-338-5p	CLIP-seq
MIRT1176400	hsa-miR-339-3p	CLIP-seq
MIRT1176401	hsa-miR-3613-3p	CLIP-seq
MIRT1176402	hsa-miR-3688-3p	CLIP-seq
MIRT1176403	hsa-miR-369-3p	CLIP-seq
MIRT1176404	hsa-miR-4268	CLIP-seq
MIRT1176405	hsa-miR-4278	CLIP-seq
MIRT1176406	hsa-miR-429	CLIP-seq
MIRT1176407	hsa-miR-4417	CLIP-seq
MIRT1176408	hsa-miR-4429	CLIP-seq
MIRT1176409	hsa-miR-4437	CLIP-seq
MIRT1176410	hsa-miR-4448	CLIP-seq
MIRT1176411	hsa-miR-4509	CLIP-seq
MIRT1176412	hsa-miR-4667-3p	CLIP-seq
MIRT1176413	hsa-miR-4674	CLIP-seq
MIRT1176414	hsa-miR-4680-5p	CLIP-seq
MIRT1176415	hsa-miR-4695-3p	CLIP-seq
MIRT1176416	hsa-miR-4743	CLIP-seq
MIRT1176417	hsa-miR-4744	CLIP-seq
MIRT1176418	hsa-miR-541	CLIP-seq
MIRT1176419	hsa-miR-548a-3p	CLIP-seq
MIRT1176420	hsa-miR-548ae	CLIP-seq
MIRT1176421	hsa-miR-548aj	CLIP-seq
MIRT1176422	hsa-miR-548am	CLIP-seq
MIRT1176423	hsa-miR-548e	CLIP-seq
MIRT1176424	hsa-miR-548f	CLIP-seq
MIRT1176425	hsa-miR-548x	CLIP-seq
MIRT1176426	hsa-miR-556-3p	CLIP-seq
MIRT1176427	hsa-miR-654-5p	CLIP-seq
MIRT2051072	hsa-miR-106a	CLIP-seq
MIRT2051073	hsa-miR-106b	CLIP-seq
MIRT2051074	hsa-miR-1293	CLIP-seq
MIRT1176380	hsa-miR-137	CLIP-seq
MIRT2051075	hsa-miR-142-5p	CLIP-seq
MIRT2051076	hsa-miR-146b-3p	CLIP-seq
MIRT2051077	hsa-miR-1538	CLIP-seq
MIRT2051078	hsa-miR-1539	CLIP-seq
MIRT2051079	hsa-miR-17	CLIP-seq
MIRT2051080	hsa-miR-1976	CLIP-seq
MIRT2051081	hsa-miR-20a	CLIP-seq
MIRT2051082	hsa-miR-20b	CLIP-seq
MIRT2051083	hsa-miR-3151	CLIP-seq
MIRT1176393	hsa-miR-3173-5p	CLIP-seq
MIRT2051084	hsa-miR-3180-5p	CLIP-seq
MIRT2051085	hsa-miR-3193	CLIP-seq
MIRT2051086	hsa-miR-340	CLIP-seq
MIRT2051087	hsa-miR-3609	CLIP-seq
MIRT2051088	hsa-miR-4483	CLIP-seq
MIRT2051089	hsa-miR-4494	CLIP-seq
MIRT2051090	hsa-miR-4497	CLIP-seq
MIRT2051091	hsa-miR-4660	CLIP-seq
MIRT2051092	hsa-miR-4705	CLIP-seq
MIRT2051093	hsa-miR-4745-3p	CLIP-seq
MIRT2051094	hsa-miR-4796-3p	CLIP-seq
MIRT2051095	hsa-miR-513a-5p	CLIP-seq
MIRT2051096	hsa-miR-519d	CLIP-seq
MIRT2051097	hsa-miR-543	CLIP-seq
MIRT2051098	hsa-miR-548ah	CLIP-seq
MIRT2051099	hsa-miR-552	CLIP-seq
MIRT2051100	hsa-miR-568	CLIP-seq
MIRT2051101	hsa-miR-665	CLIP-seq
MIRT2051102	hsa-miR-764	CLIP-seq
MIRT2051103	hsa-miR-874	CLIP-seq
MIRT2051104	hsa-miR-93	CLIP-seq
MIRT2280200	hsa-miR-1193	CLIP-seq
MIRT2391425	hsa-miR-4649-5p	CLIP-seq

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001771	Process	Immunological synapse formation	IEA
GO:0001784	Function	Phosphotyrosine residue binding	IPI	20624904
GO:0005515	Function	Protein binding	IPI	10026169, 10574708, 12110186, 12606549, 15350535, 15721255, 15764601, 16189514, 16273093, 16337946, 16752908, 17617578, 18086875, 18539162, 19807924, 21516116, 22074159, 23455922, 24338975, 24728074, 25416956, 25814554, 25910212, 26871637, 28514442, 29892012, 31515488, 31980649, 322
GO:0005737	Component	Cytoplasm	IDA	25468996
GO:0005737	Component	Cytoplasm	NAS	12110186
GO:0005783	Component	Endoplasmic reticulum	IDA	16835242
GO:0005829	Component	Cytosol	TAS
GO:0007015	Process	Actin filament organization	IEA
GO:0007165	Process	Signal transduction	TAS	9737977
GO:0007172	Process	Signal complex assembly	NAS	12110186
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	TAS	9737977
GO:0007176	Process	Regulation of epidermal growth factor-activated receptor activity	TAS	9737977
GO:0008093	Function	Cytoskeletal anchor activity	NAS	12110186
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9737977
GO:0012506	Component	Vesicle membrane	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016477	Process	Cell migration	IEA
GO:0030032	Process	Lamellipodium assembly	IEA
GO:0030159	Function	Signaling receptor complex adaptor activity	NAS	12110186
GO:0030838	Process	Positive regulation of actin filament polymerization	IMP	12110186
GO:0033137	Process	Negative regulation of peptidyl-serine phosphorylation	IDA	16835242
GO:0035591	Function	Signaling adaptor activity	NAS	16835242
GO:0036493	Process	Positive regulation of translation in response to endoplasmic reticulum stress	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IMP	12110186
GO:0042110	Process	T cell activation	NAS	12110186
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10026169
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0060996	Process	Dendritic spine development	IEA
GO:0097110	Function	Scaffold protein binding	IEA
GO:1902237	Process	Positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IEA
GO:1903898	Process	Negative regulation of PERK-mediated unfolded protein response	IEA
GO:1903912	Process	Negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation	IDA	16835242
GO:1990441	Process	Negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IEA

MIM	HGNC	e!Ensembl
604930	7665	ENSG00000071051

Protein

UniProt ID

O43639

Protein name

Cytoplasmic protein NCK2 (Growth factor receptor-bound protein 4) (NCK adaptor protein 2) (Nck-2) (SH2/SH3 adaptor protein NCK-beta)

Protein function

Adapter protein which associates with tyrosine-phosphorylated growth factor receptors or their cellular substrates. Maintains low levels of EIF2S1 phosphorylation by promoting its dephosphorylation by PP1. Plays a role in ELK1-dependent transcri

PDB

1U5S , 1WX6 , 1Z3K , 2B86 , 2CIA , 2FRW , 2FRY , 2JXB , 4E6R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	8 → 53	SH3 domain	Domain
PF14604	SH3_9	118 → 166	Variant SH3 domain	Domain
PF00018	SH3_1	201 → 249	SH3 domain	Domain
PF00017	SH2	285 → 359	SH2 domain	Domain

Sequence

MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKF
AYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFL
SLRKGASLSNGQGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNA
RGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECALN
ERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHYK
KAPIFTSEHGEKLYLVRALQ

Sequence length

380

Interactions

View interactions

	KEGG		Reactome
	ErbB signaling pathway Axon guidance T cell receptor signaling pathway Pathogenic Escherichia coli infection		Downstream signal transduction Nephrin family interactions Ephrin signaling VEGFA-VEGFR2 Pathway

Associated diseases

Show/Hide Causal Diseases (1)

Causal
Disease name	Disease term	dbSNP ID	References
Nephrotic syndrome	Nephrotic Syndrome	rs876657369, rs121912601, rs121912602, rs876657370, rs121912603, rs121912604, rs121912605, rs121907900, rs121907901, rs28941778, rs587776576, rs28942089, rs587776577, rs28941777, rs121907910, rs1568296260, rs119473033, rs74315342, rs74315343, rs74315345, rs74315346, rs74315347, rs74315348, rs121434394, rs267606919, rs121912488, rs267606953, rs267606954, rs267606955, rs104886210, rs1591732280, rs1591750243, rs140511594, rs140781106, rs147972030, rs587776969, rs386833863, rs386833880, rs386833882, rs386833892, rs386833895, rs386833909, rs386833911, rs386833920, rs386833935, rs386833947, rs1555763603, rs398122978, rs398122979, rs398122980, rs369573693, rs398122981, rs398122982, rs398122983, rs200482683, rs730882194, rs180177201, rs587777552, rs587777553, rs775170915, rs749740335, rs12568913, rs530318579, rs786204583, rs786204708, rs786204632, rs138656762, rs797044992, rs797044994, rs797044995, rs864321632, rs864321687, rs864321688, rs864321633, rs869025495, rs869025541, rs869312747, rs145473779, rs757674160, rs869320695, rs138909849, rs869312984, rs1057516900, rs763818901, rs199506378, rs1057517164, rs1057516523, rs1057516414, rs778055996, rs1057516395, rs1057516747, rs1057516880, rs1057516680, rs778217926, rs1057519347, rs764587648, rs1060499703, rs121907903, rs769259446, rs1131692252, rs1131692253, rs1131692254, rs1131692255, rs1131692256, rs746887949, rs1131692235, rs1135402911, rs1135402912, rs1135402913, rs1554946480, rs1555331969, rs773173317, rs1555816634, rs775006954, rs1320543506, rs534522842, rs1272948499, rs1191455921, rs1291398331, rs1554939785, rs776016942, rs1031744496, rs748812981, rs755972674, rs1553312833, rs967339926, rs1462028977, rs1212702104, rs1167223941, rs762631237, rs1553316575, rs1553315173, rs1553316648, rs1553316611, rs780761368, rs368572297, rs1568070817, rs1321552081, rs1558108130, rs1558091788, rs1565707103, rs1558355124, rs1564622701, rs1351580598, rs1589475328, rs1589413498, rs1572255744, rs1572262824, rs761410195, rs1602413491, rs1590326226, rs375998390, rs570583897, rs369363545, rs201488687, rs1334894971, rs763782471, rs138047529, rs895782232, rs1572255047, rs1589433172, rs1589509476, rs1572277600, rs1572282458, rs1584675898, rs759043857, rs1853443391	19443634

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412